KEGG   Cryptococcus neoformans B-3501A: CNBD0570Help
Entry
CNBD0570          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K10908  
DNA-directed RNA polymerase, mitochondrial [EC:2.7.7.6]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.6  DNA-directed RNA polymerase
     CNBD0570
Mitochondrial biogenesis [BR:cnb03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial RNA polymerase
    CNBD0570
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1202 aa AA seqDB search
MRIPEAKVWAMVIEGVASLGNVHSHGSSAPKWRGRAARLVEQWGETHGARGSKEPAGLDR
DGLRVYQGWFNGLINSHSPLDPIIPYLEHSSLPISSLLQGLEPSALPLACQAVIEAADSH
SLPGLRQDVLAFQGLEKQRREELVSEVIEEVTPVTENAGKSSKQAHVSHRNEARFAIANL
RQALSAIDSSSIPVNRQRALENASLQAARAELEESAKRIQAAGDTSTLQRSVLQSWMHTW
LGELTVELEKRIASMQAEIDALPESKAAVTPPKYSATARMKPQVLLMYLSLLPVDKLALI
TILEIMRMSGSGGIADGMKVLRGMVAVGKAVETEFRAETIKNVAGVDSYHWLKTIDPQTQ
KPSRQLIGSVWKKIGEQANQAKRVGKNEGDKILPPNHDDMQDIWTPAWSRMIQLGVGSEL
VDALLKVAKVERTAKDRNTGEMITELQPAFTHAYEYVRGKKLGVIKLNPVVAARLAKDDI
GVVIHPKHLPMLVEPRPWTAHNKGGYLLHSVPVMRYKESLEQQKWLKAASEEGHLEPVFH
GLDVLSSTPWRVNRRVFDVVLESWNRGEPIADIPPSEDKAHYEFPEKPDSSDQDPQMRVQ
YVEKTKAVLAQQRKDHAERCKFNYNIEIARSYLKDTFYLPHNMDFRGRAYPIPPHLSPVG
DDLCRGLLTFGTKKPLGETGLKWLQIHLANVYGYDKASFAERARFAQEHEADIFDSADHP
LDGKRWWLKAEDPWQCLATCFELASALRSPNPSAYESSLPVHQDGTCNGMQHYAALGGDV
RGAKAVNLEAGDRPADIYTGVVDIVNKVVEEDKKAGHDIALLIKEPLGRKVVKQTVMTTV
YGVTFVGARDQIAKQLHARGDIAQEHIFAVSSYIAKTVLNCIGDLFSGAKAIMDWLTTSA
RLISRSIPPARVQEAATNLTNTSRTGKVTSRAAKEFMSAVIWTTPLGLPVVQPYRKAHKK
QIMTALQSVYISDPNAPSEVSPQKQATAFPPNFIHSLDATHMLLTALKCKQNNLAFASVH
DSYWTHAATVEKMSDLIRDTFVELHSQDLVGKLREDFLDRYGEYCIPIQSAKNISTTAAK
RKAATAQRRKAMSVMLAEHDGGEESFTNSDPDGRFDDAILNAEVDLIASTPEQLDVKAAE
AISLPTDGIVEIAGKSGLDDEEVDIFRAGKQNWVKFRDVLPPCPPRGVFEVRRVKQSAYF
FS
NT seq 3609 nt NT seq  +upstreamnt  +downstreamnt
atgagaataccagaagccaaagtatgggcaatggtcattgaaggagtggcaagtctcggt
aacgtccacagccatgggtctagtgctccaaagtggaggggaagggccgcgagattagta
gagcagtggggagagacacacggcgcgcgaggttcgaaagagccagctggtctggatcgt
gacggtttgagggtctaccagggctggttcaatggtttgatcaactcccactctcctctg
gatcccataatcccttaccttgaacactcttctctgcccatttcatctcttctccaaggc
ctcgaaccttccgcgttaccattagcttgtcaggcggtcattgaagccgccgactctcac
tctttgccgggtcttcgacaagatgtcctcgctttccaggggcttgaaaagcaaagacga
gaggaactcgtctctgaagtaattgaggaggtcacgcccgtaacagagaatgctggcaaa
tctagcaagcaagcacacgtctcccatcgtaacgaagctcggttcgccatcgccaatctt
cgtcaagctttatccgccatagactcttcctccattcccgtaaaccgccaacgtgcactt
gagaatgcatctctccaagcagcccgcgcagaactcgaagagagcgccaaacgtatccaa
gcagccggtgacacatccacccttcaacgatctgtccttcaatcatggatgcatacttgg
cttggtgaactcactgtagaactcgagaagcgtattgcgtccatgcaggccgaaattgac
gctcttccagaatccaaagccgctgtcacccctcctaaatactccgccactgctcgcatg
aagcctcaggttctcctcatgtacctctcccttctcccggttgataagctcgcccttatc
actatcctcgaaatcatgcgcatgtccggatcaggcggtatagctgatggtatgaaggtt
ctgagaggcatggttgccgtcggcaaggctgtggaaactgagtttagggcagaaacgatc
aagaatgttgctggtgttgattcgtatcactggttgaaaactatcgatccccaaactcag
aaaccaagcagacaactcatcggatcagtttggaaaaagattggagaacaggcgaatcaa
gcaaagcgtgtaggtaaaaatgaaggtgataaaattttgcctcccaaccacgacgacatg
caagatatatggacccctgcctggtcccggatgattcagctcggcgtcggttccgagttg
gtcgatgcattgttaaaagtggcgaaggtcgaacgaacagccaaggatcgtaacactggt
gagatgataacggagctccagccggctttcactcatgcgtacgagtacgtgcgcgggaag
aagcttggcgtcatcaaacttaaccctgtggttgctgcccgcctagcaaaagacgacatc
ggcgtagtcatacatcctaagcacctgccaatgcttgtcgaacctagaccttggacagcc
cataataaaggcggttatctactccattcagtccccgttatgcgctataaagagtcctta
gaacaacagaaatggctcaaggcagcgtcggaagaaggacatcttgaaccagtatttcac
ggtctagacgttctttcttcaaccccttggcgggtcaatcgtagagtgtttgacgtcgtg
ctcgagtcttggaatagaggcgagccgatcgccgatattcctccatcagaagacaaagca
cactatgaatttcccgagaaacctgattcatctgatcaagatccgcaaatgagggtccaa
tatgtggagaagacaaaagccgtcttggcccaacaaagaaaggaccacgctgaaaggtgc
aagttcaattacaatattgaaattgcgcgctcctatcttaaagacactttctatcttccc
cacaatatggatttccgaggaagggcttatccgatccctcctcatctgagtcctgtagga
gacgacctttgtcgaggtcttcttacttttggtaccaaaaaaccccttggtgaaacaggt
ctgaagtggttgcaaatccacttggcaaatgtgtatggttatgacaaggccagcttcgct
gaaagagcaagatttgcgcaggaacacgaagctgatatcttcgatagtgccgaccacccc
ttggacggaaaacggtggtggctgaaagctgaagacccatggcaatgcctcgccacatgt
tttgaactcgcctccgctttacgctcgcccaatccttcagcctatgagtcgtctcttcct
gttcatcaggatggcacttgtaacggtatgcagcactatgctgctcttggtggcgatgtt
cgtggtgccaaagccgtcaacctcgaagcaggagaccggccagcagatatctataccggt
gtcgtcgacatagtgaacaaggtggtcgaggaagacaagaaggccggtcacgacatcgcg
ttgttaatcaaggaacctctcgggagaaaggtcgtaaaacagacagtaatgactacagtc
tatggagtaactttcgttggtgcacgagaccagattgccaagcaattgcacgctagaggt
gatattgcacaggagcacatatttgccgtatcaagttatattgctaaaactgtgttaaat
tgtatcggtgaccttttctctggagccaaggccatcatggactggcttaccacgtctgcc
cgtttaatctctagatcgattcccccagctcgtgtccaagaagcggccactaatttaaca
aacacctctcgcacaggcaaggtcacttcccgggctgccaaagaatttatgagtgcggtc
atctggacgacccctctgggtttgcctgttgtgcaaccatatagaaaagcgcacaagaag
cagatcatgaccgctttacaatctgtgtacatctcagaccccaacgctccgtcagaagtc
agccctcaaaaacaagcaaccgctttccctccgaatttcattcactctcttgacgccact
catatgctccttaccgctctcaagtgtaaacaaaataacttggcctttgcaagtgtgcat
gattcttactggactcacgctgctacagtcgaaaaaatgtccgaccttatccgagacacc
tttgtagaacttcactctcaggatcttgtcggcaaacttagagaggatttccttgaccga
tatggcgagtactgtatcccaatacagtcagctaaaaatatatctaccaccgctgccaag
cgtaaagctgcgactgcccagcggagaaaagccatgtctgtaatgttggctgaacatgat
ggcggcgaagagtcttttaccaactccgatcctgatggcagattcgatgacgctatatta
aatgccgaagttgatctcattgcatcaactcctgagcaactcgatgtgaaagctgcagag
gctatatctctccctaccgatggaattgtagaaatagcaggtaaatctggcttggacgat
gaggaagtggatattttccgtgcaggaaagcagaattgggtcaagtttagggatgtcttg
ccgccttgtcctcctaggggtgttttcgaggtccgtagggtaaagcagtccgcctacttc
ttttcctga

DBGET integrated database retrieval system