KEGG   Cryptococcus neoformans B-3501A: CNBD0640Help
Entry
CNBD0640          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNBD0640
Translation factors [BR:cnb03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CNBD0640
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 753 aa AA seqDB search
MSAADLDYFSEDEQREIEAELDTGFKDIEEKYAVTAQKGFETMLVVDNIPIVDGSKKQRL
LERLRQTFAKVGAPIEEESIDMPWNAAAGTNKGFVFLTYPDVKEAENAVHTLDGVSFGKN
VLHVNRFGDIQRFASMPVGEGDLPSGWKEKEYIEKDYLRNWLGDIAGRDQYVTFWETEVT
VWWNGRNGTAEALKGPDGKPVKNSKWGELYLQWSTMGTYLASLHRVGVALWSGPKLDGPI
GVNVLRFTHPNVRLIQFSPCENYLVTWSEDPLPNYENHPNAALRDTFGPEDEGNQYVIWD
IKTTRVLRTFPGDKSAIGVDDTQSRMSWPTFKWSADDSYIAKCNVGAGISVYELPTMGLL
DRKSIKIEGVQDFEWCPMSQKDLIARQEGKGKECVLAFWTPEAQNQPARVNIMAVPSRTI
LRSKNLFNVSECKFYWQSQGDFLCVKVDRHARKAKSKKATSCNLEIFRMREKDYPVEVLE
FKDYVPQFAWEPSGTRFAIVLQAETNLPSVSGASTKYSIDFYQLDSKKGDFIAIKHLDSK
MANTLVWSPKGRHIALATIGSSSKYDIEFWDLDFTIDERREAAELGANVTMLGTGEHYGI
TEIAWDPSGRYIATSASTWRQSPEPGFSIWDFKGQQLLHESRDRFKQFLWRPRPPTLLSK
DQIKKVRKELREYSRQFDEEDAAEENRGSAEKLAQRRREIGEWNAWRTRNNDRLAFEREN
RGKSKAKIDVKGQEARVEEWVEELIDETEELSM
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtccgccgccgacctagactatttttcagaagatgagcagcgtgagattgaagctgag
ctcgacactggcttcaaggacattgaggaaaagtatgctgtgaccgcccagaagggcttt
gagacgatgttggtcgtcgacaacattcctatcgtagacggtagtaagaagcagagactg
ttggagcgattgagacagacattcgccaaagtgggcgcgcccatcgaggaggaaagtata
gacatgccttggaacgcagcagctggtactaacaaaggtttcgttttcctgacatacccc
gatgtgaaggaagcggaaaatgccgtccacactctcgacggtgtatcctttggtaaaaac
gtgctgcacgtaaatcgatttggagacattcaacgcttcgccagtatgcctgttggagag
ggcgatctgccatcgggctggaaagaaaaggagtatattgagaaggattacttgcgaaat
tggcttggggatattgctgggagagaccagtatgtaaccttctgggaaacagaggttact
gtctggtggaacggacgcaatggaaccgccgaggcattaaaggggcccgacggtaaacct
gtgaagaacagtaaatggggtgagttgtacctacagtggtccaccatgggaacctacttg
gcttcgcttcatcgtgttggcgttgccctatggtccggtcccaaactcgatggacccatt
ggcgtcaatgtgctcagattcactcaccccaatgttcggcttatccaattttccccctgc
gagaattatctcgttacctggtcagaagatcctcttccaaattatgagaatcatcccaat
gcagctctgcgagacactttcggtcctgaagacgaaggaaaccagtatgtcatttgggac
atcaagacgacacgtgttcttcggacattccctggtgataaatctgcaattggggtagat
gatactcaatcccgcatgtcgtggccaaccttcaagtggtctgcggatgactcgtatatc
gctaagtgcaatgtcggcgcggggatttcagtgtatgaactgcccactatgggattgttg
gatagaaagagtatcaaaatcgagggggtacaagactttgaatggtgtcctatgagccag
aaggatttgatagcgagacaagaaggaaagggaaaggagtgtgttctagccttctggacc
cctgaagctcagaatcagcccgctagagtgaacataatggctgtaccaagccggacgatc
ttgagatcaaagaacctgtttaatgtctctgaatgtaaattctattggcagagtcaaggt
gatttcctttgtgtaaaggttgatcgccatgctcgaaaggccaaatccaaaaaggcaact
tcgtgcaatttagaaattttccgcatgcgcgagaaagattaccctgtggaggttcttgaa
tttaaagattacgttccgcaatttgcatgggagccttcgggcactcgctttgccatcgtt
ctccaagcagaaacaaatcttccatcggtctcaggggcgtcgaccaagtacagcatcgat
ttctatcagcttgattccaagaagggagatttcatcgcaattaaacatcttgacagcaaa
atggccaatactctcgtctggtcacccaagggtcgtcatatcgcattggccaccatagga
tcgtccagcaagtatgatatcgaattctgggaccttgacttcactatcgacgaaaggcga
gaggctgctgagcttggggctaacgtaactatgttgggcactggggaacattacggcatc
acagagattgcttgggatcctagtggacggtacattgcgacttctgcatctacatggcga
cagtcccctgagcctggcttttctatttgggatttcaaaggtcaacaacttctgcacgaa
tcacgggatcgtttcaagcagttcctttggcggcctcgtcctcctacgctgcttagtaag
gatcagattaagaaggtcagaaaggaacttcgagaatattcgcgacagtttgatgaagaa
gatgctgcggaggagaaccgagggagtgccgagaagctcgcccagcgtcgcagagagatc
ggcgagtggaatgcttggaggactaggaacaacgacaggctggcttttgaacgcgagaac
agaggcaagtcaaaggcaaagatcgatgttaaagggcaggaggcacgggttgaggagtgg
gtcgaagaacttatcgatgagactgaggaattgtcgatgtaa

DBGET integrated database retrieval system