KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBD1530Help
Entry
CNBD1530          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00230  Purine metabolism
cnb01100  Metabolic pathways
Module
cnb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CNBD1530
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CNBD1530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_16 AAA_33 RsgA_GTPase AAA_18 ABC_tran Septin AAA_24 MMR_HSR1 AAA_29 AAA_21 FtsK_SpoIIIE RNA_helicase AAA_28 AAA_14 Rad17 ATPase_2 AAA_23 AAA_30 AAA NACHT cobW Adeno_IVa2 AAA_19 Roc IstB_IS21
Motif
Other DBs
NCBI-GeneID: 4935542
NCBI-ProteinID: XP_776105
UniProt: F5HA73
Position
4
AA seq 217 aa AA seqDB search
MSRPINPDVVNRPLVICGPSGTGKSTLLKTLFESQPDTFGFSVSHTTRKPRPGEENGREY
HFVTKEEFMEGVGKGEFLEWAEFGGNCYGTTFAALTALHPRRCILDIELQGVLQLKAKAP
LQTPPLEPVFLFLSPPSISQLKSRLSGRGTETDASIRKRLDAAKEELRYAKEGKYDVYVV
NDDLKVAGEKLEKVAMGWEGWKTCGDVLPELNLAELD
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaggcccatcaatccagacgtcgtcaaccgcccacttgtgatttgcggcccttct
ggtaccggaaaatctaccctcctcaagactctttttgagagccagcctgatacctttggt
ttttccgtctctcatactactcgaaagcctaggcccggggaggaaaatggccgagaatac
cactttgtcaccaaggaagagtttatggagggtgtcggcaagggcgaatttttggagtgg
gccgaattcgggggcaattgttacggaactacatttgctgccttgaccgcccttcatccc
cgccgatgcattctcgacattgaactgcaaggtgtccttcagctaaaggctaaggccccg
ctccaaacccctcccctcgaaccggtgtttctcttcctttctccgccttccatttctcaa
cttaaatcccgtttgtctgggcgaggtaccgagaccgacgcctccatccgaaagaggctc
gatgctgccaaggaggagctgaggtacgcgaaggagggcaaatatgatgtttacgttgtc
aacgatgatctgaaggtggctggcgaaaagcttgagaaagttgcgatgggttgggagggc
tggaagacttgcggtgacgtcttgccagagctgaacttggctgaacttgactaa

DBGET integrated database retrieval system