KEGG   Cryptococcus neoformans B-3501A: CNBD1960Help
Entry
CNBD1960          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    CNBD1960
   03420 Nucleotide excision repair
    CNBD1960
   03430 Mismatch repair
    CNBD1960
   03440 Homologous recombination
    CNBD1960
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 266 aa AA seqDB search
MNNYDGQNPYYGGAGGGYVAGGSPYGSQDSPSRKARGGNQTIRPVTVKQILDAQQVHPDA
DFTIDGVDVAQVLLIGSVRNMSTTATNISYEIGDGTGYIDARVWLDSADDESGKTTGIEQ
DHYVGLMGTIKVFGGKRHVSATHIRPITDGNEVQHHLLKALYVSLILRGGTPGNAPKAAG
THDDYNAGATTGATDQSAWSHLEPLQRRILEVLSSEGQGNDDGVHVTHIIKFLNGADEND
FTVALDWLTDNGYVYSTLDESHYQVL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgaacaactacgacggtcagaacccatactacggaggagccggtggaggatacgtcgcg
ggcgggtctccctacggcagccaagactcaccgagccgtaaagccagaggagggaatcag
actattaggcctgtgacggtgaagcaaatcctcgacgctcagcaagttcatcccgacgcg
gatttcacaatagacggcgtggacgtagctcaagtgcttttgatcggctctgtgcggaat
atgtcgacaaccgcgacaaacatttcctacgaaattggggacggtactggttatatcgat
gctcgtgtgtggctcgactcagcagatgatgagtcggggaagactacgggaattgaacag
gaccattatgttgggcttatgggcacaatcaaagtatttggcggcaaaaggcacgtgtct
gcaactcatatccgacctataacagacggcaatgaagttcagcaccatctcctcaaagct
ctctatgttagcttgatactgagaggtggcactcctggtaacgccccgaaagctgctggc
acccacgatgactacaatgccggagcgactactggcgcaactgaccagtctgcctggtcg
catctagagcctctgcagcgtagaattctagaagtcttgtcgagcgaaggacagggcaat
gatgatggtgtccatgtgacgcatatcatcaagtttctcaatggggctgatgaaaatgat
ttcacagtggcacttgattggttgacagataacggatatgtttattcgacacttgacgaa
tcccactatcaagttctgtag

DBGET integrated database retrieval system