KEGG   Cryptococcus neoformans B-3501A: CNBD2830Help
Entry
CNBD2830          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cnb00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 398 aa AA seqDB search
MYGRLGVSILLMAAASNVLAKIQEDDGYSEQLDPWNDEYANTPDLSFSGVASFAHLPHKR
CLDVKDAAFDIALLGVPFDSAVSFRPGARFGPYALRSGSRRQRPDRGYNSRLEVNPYSGD
LSILDCGDVPVTPFDPATAVKQINSAYRSLLHHPVVSPEKMQNLNMQRGLDGKIHPRIIT
LGGDHTIVLPILNAVHEVYGPVSVIHFDAHIDTWNPHRYVGSVSVQADLNHGTFFWHAYE
KGFIKPNSSIHAGIRTRFGGPQDLEDDVTAGFDLIHTFDLDDFGIDWITEKIKNRIGDGP
VVISLDVDVMDPAFVPATGTPESGGWTSRELRRILHSLIGLNIVALDIVELSPAYDTNAE
ISAIAAADMVYDFLSILALGVEHRNDGVSGTKTLKDEL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggcggctcggtgtctccattcttctgatggcagctgcatcaaatgtactagcc
aaaattcaagaagacgacggttatagcgaacagctcgacccctggaacgacgaatatgcg
aacactccagacttgagcttcagtggagtagcaagttttgcccatctcccacataaaagg
tgcttggacgtcaaggatgcagcatttgatattgctctattgggtgtgccttttgactct
gctgtttcatttcggcctggcgcgaggtttggaccatacgctttgagaagtggctcacga
aggcagcggcctgaccgtggctacaacagcaggttagaagtcaacccatattcaggagat
ctctccatacttgattgtggtgacgttcctgtgacacctttcgatcctgcaactgcggta
aagcaaatcaactcagcatatcgatccttactccatcatcctgttgtatcaccagaaaag
atgcaaaacctaaacatgcagcgaggtctcgatggaaagatacacccccggatcatcact
ctgggcggcgatcataccattgttcttcctatcctcaatgccgttcatgaagtctacggg
ccagtctctgtcattcattttgatgctcatatcgacacatggaacccacacagatatgtt
ggcagtgtctcggtccaggctgaccttaaccatgggactttcttttggcatgcgtacgag
aaaggtttcataaagcctaattcatccatccatgctggtataaggacccgctttgggggc
ccccaagatttggaagatgatgtgactgcaggatttgatcttatccatactttcgatttg
gatgactttgggattgactggatcacagagaagattaaaaacagaatcggtgatgggccg
gtcgtgattagccttgacgtcgatgtcatggatcctgcctttgtacctgctactggtacc
ccggagtccggtggatggacttctcgagagcttcgtaggatccttcactcacttattggg
ctcaatatcgtagccttggacattgtggaactttcgcctgcttatgataccaatgccgag
atatcggccattgccgcagcggacatggtgtacgactttttgtctatcctcgctctcggt
gtagagcatcgcaacgacggcgtcagtgggacaaagacattgaaggatgagctttga

DBGET integrated database retrieval system