KEGG   Cryptococcus neoformans B-3501A: CNBD3550Help
Entry
CNBD3550          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cnb00561]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 759 aa AA seqDB search
MSRPIDLSMSSVKNPSPLAAGGTGGFTPVFEASPANSPAGSRRPSISQPTARRPSEVSIS
RRPSVNHQYSSYVSQYPQQGSLSRRSSMASGPRPIRRGEYSGPVTPSVLSRAGSPTLPLG
NEFTQAPRSYYEGASGYTPLGGTRELRNGQFIGSLDCGTTSTRFIIFDKRAKIIAEHQTE
FEQILPHAGWHEHDPDALVEAMNECIIKAVEKLEWMGWSRNSIKGIGITNQRETTVCWSR
STGKPLCNAIVWDDARTINVVREMEKKLDEEGLEIDDEEEDEINQKSKIVPDEVEMGTGT
HEAAFGEKGDVVDGDTSMTGKIGKAMEGLGLSGRGKDGKAKKYRKGKEGLVDVTGIPLST
YFSAIKLRWMLDHQKAVRIAHEADDLMFGTVDTWLVYNLTGANNGGLHIIDVTNASRTLL
ISLKTLRWHAPLLRFFGLRASILPKIVSSAEVYGNISDSLGLPLSGVPIAGIVGDQQAAL
VGNKCLMKGQAKCTYGTGAFVLFNTGEDIVRSNYGLISTVAFQAGADSKPVYALEGSIAV
AGSAIKWLRDQMTLIEESAEMDILAGSVSDTGGVYFVTAFSGLLAPYWDREASGTIIGLT
GYTTSAHIARATLEAVCFQTRAVLDVIEKESGSRLDTLKVDGGVTNSDLAMQLQANIGGF
NVARPSMRESTALGSALLAAHALGLFGWDLTRPETLSEVNTAGVHTFEPELEEKARLKKI
KGWNKAVDRAKKWHDIDDEDDEEEEYENEAGYAKIIGSA
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccccatagacctttctatgtcctcggtcaagaacccctcgccccttgcggca
ggcggtaccggtggctttacccctgtcttcgaggcttctcctgccaattctcccgcaggt
tctcgtcgaccttctatctcacagcccacagctcgtcgcccttcagaagtctcgatttct
cgtaggccttctgtaaatcaccaatacagtagctacgtctcgcaatatcctcaacaaggg
tctctttcccgacgatcatctatggcttccggcccgcgacctatccggcggggcgaatat
tctggacctgtcacgccgtctgtcctatctcgagctggttcgcctaccttgcccctcggt
aacgaattcactcaagctccaaggtcatactatgagggtgcttcaggctacactcctttg
ggcggaacgcgggagttgcgtaatgggcaatttattggtagtctggattgtggtactacc
tctacgcgattcatcattttcgataagcgagcaaagattatcgcagagcatcaaaccgaa
ttcgaacagattctccctcatgcaggttggcatgagcatgaccccgacgcgctagttgaa
gcgatgaacgaatgtatcatcaaagctgttgaaaagctcgaatggatgggctggtccaga
aatagcatcaagggtattggtattaccaatcaacgagagacgactgtctgctggtcacgt
tctactggcaagcctctgtgtaatgctatcgtttgggatgatgcgcgaactatcaatgtg
gttcgtgagatggaaaagaagctcgacgaggagggcctggaaattgatgacgaggaggag
gacgagatcaatcaaaagtctaaaattgtgccagacgaagttgagatgggaactggtacg
catgaggcagccttcggggagaaaggtgatgtcgtagatggtgataccagtatgactggc
aaaattggaaaagcgatggagggtctcggcttgtcaggccgaggtaaagatggaaaggcg
aaaaagtacagaaagggcaaggaaggtctggtggacgttaccggtattcctctctctact
tacttttctgccatcaaacttcgatggatgttggatcatcaaaaggccgtccgaatcgcc
catgaagctgatgatctgatgttcggtactgttgatacttggcttgtctataatttgacc
ggtgccaacaatggcggtctccatattattgacgttaccaatgcctctcgaacactcctt
atctctcttaaaacacttcgatggcacgctcctctccttcgcttcttcggccttcgagct
tcgatccttccaaagatcgtgtcttcagccgaagtgtacggcaatatttctgattcactt
ggcctaccgctttccggtgttccaattgccggtattgttggtgaccaacaggccgcgctc
gtcggcaacaaatgtttgatgaagggccaggccaagtgcacttatggtaccggtgctttc
gtcttattcaacacgggcgaagacattgtgagaagcaactacggtctcatttctaccgta
gcctttcaagcaggtgcggacagtaagcctgtatatgcattggaaggttctattgccgtg
gctggatcggccataaaatggctacgagaccaaatgacccttattgaagaatctgccgaa
atggatatcctcgccggatcagtgtcggacactggaggtgtctattttgttaccgccttc
tctggccttcttgcgccgtattgggatcgtgaagcttctggcactatcattggtcttact
ggatacacaacttctgcccacattgcgcgggccacccttgaggctgtgtgtttccaaact
cgcgcggttttagatgtcatcgagaaagagagtggtagcaggctcgacacactcaaggtt
gatggtggtgtgaccaactcagacttggctatgcaattgcaggctaacatcggtggcttc
aacgttgcacgaccttcgatgcgcgagtctactgcgcttggttccgctttgctggccgct
catgctcttggtctgtttggttgggatctgacccgtccagaaactctcagtgaggtgaac
accgctggtgtccatacattcgagcccgagttggaggagaaagccagactgaagaagatc
aagggatggaataaggctgttgatagggccaagaaatggcatgacatcgacgatgaggac
gacgaagaagaagaatacgaaaacgaagccggatacgctaagatcatcgggtcggcttaa

DBGET integrated database retrieval system