KEGG   Cryptococcus neoformans B-3501A: CNBD3550Help
Entry
CNBD3550          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    CNBD3550
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     CNBD3550
Exosome [BR:cnb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   CNBD3550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 759 aa AA seqDB search
MSRPIDLSMSSVKNPSPLAAGGTGGFTPVFEASPANSPAGSRRPSISQPTARRPSEVSIS
RRPSVNHQYSSYVSQYPQQGSLSRRSSMASGPRPIRRGEYSGPVTPSVLSRAGSPTLPLG
NEFTQAPRSYYEGASGYTPLGGTRELRNGQFIGSLDCGTTSTRFIIFDKRAKIIAEHQTE
FEQILPHAGWHEHDPDALVEAMNECIIKAVEKLEWMGWSRNSIKGIGITNQRETTVCWSR
STGKPLCNAIVWDDARTINVVREMEKKLDEEGLEIDDEEEDEINQKSKIVPDEVEMGTGT
HEAAFGEKGDVVDGDTSMTGKIGKAMEGLGLSGRGKDGKAKKYRKGKEGLVDVTGIPLST
YFSAIKLRWMLDHQKAVRIAHEADDLMFGTVDTWLVYNLTGANNGGLHIIDVTNASRTLL
ISLKTLRWHAPLLRFFGLRASILPKIVSSAEVYGNISDSLGLPLSGVPIAGIVGDQQAAL
VGNKCLMKGQAKCTYGTGAFVLFNTGEDIVRSNYGLISTVAFQAGADSKPVYALEGSIAV
AGSAIKWLRDQMTLIEESAEMDILAGSVSDTGGVYFVTAFSGLLAPYWDREASGTIIGLT
GYTTSAHIARATLEAVCFQTRAVLDVIEKESGSRLDTLKVDGGVTNSDLAMQLQANIGGF
NVARPSMRESTALGSALLAAHALGLFGWDLTRPETLSEVNTAGVHTFEPELEEKARLKKI
KGWNKAVDRAKKWHDIDDEDDEEEEYENEAGYAKIIGSA
NT seq 2280 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgccccatagacctttctatgtcctcggtcaagaacccctcgccccttgcggca
ggcggtaccggtggctttacccctgtcttcgaggcttctcctgccaattctcccgcaggt
tctcgtcgaccttctatctcacagcccacagctcgtcgcccttcagaagtctcgatttct
cgtaggccttctgtaaatcaccaatacagtagctacgtctcgcaatatcctcaacaaggg
tctctttcccgacgatcatctatggcttccggcccgcgacctatccggcggggcgaatat
tctggacctgtcacgccgtctgtcctatctcgagctggttcgcctaccttgcccctcggt
aacgaattcactcaagctccaaggtcatactatgagggtgcttcaggctacactcctttg
ggcggaacgcgggagttgcgtaatgggcaatttattggtagtctggattgtggtactacc
tctacgcgattcatcattttcgataagcgagcaaagattatcgcagagcatcaaaccgaa
ttcgaacagattctccctcatgcaggttggcatgagcatgaccccgacgcgctagttgaa
gcgatgaacgaatgtatcatcaaagctgttgaaaagctcgaatggatgggctggtccaga
aatagcatcaagggtattggtattaccaatcaacgagagacgactgtctgctggtcacgt
tctactggcaagcctctgtgtaatgctatcgtttgggatgatgcgcgaactatcaatgtg
gttcgtgagatggaaaagaagctcgacgaggagggcctggaaattgatgacgaggaggag
gacgagatcaatcaaaagtctaaaattgtgccagacgaagttgagatgggaactggtacg
catgaggcagccttcggggagaaaggtgatgtcgtagatggtgataccagtatgactggc
aaaattggaaaagcgatggagggtctcggcttgtcaggccgaggtaaagatggaaaggcg
aaaaagtacagaaagggcaaggaaggtctggtggacgttaccggtattcctctctctact
tacttttctgccatcaaacttcgatggatgttggatcatcaaaaggccgtccgaatcgcc
catgaagctgatgatctgatgttcggtactgttgatacttggcttgtctataatttgacc
ggtgccaacaatggcggtctccatattattgacgttaccaatgcctctcgaacactcctt
atctctcttaaaacacttcgatggcacgctcctctccttcgcttcttcggccttcgagct
tcgatccttccaaagatcgtgtcttcagccgaagtgtacggcaatatttctgattcactt
ggcctaccgctttccggtgttccaattgccggtattgttggtgaccaacaggccgcgctc
gtcggcaacaaatgtttgatgaagggccaggccaagtgcacttatggtaccggtgctttc
gtcttattcaacacgggcgaagacattgtgagaagcaactacggtctcatttctaccgta
gcctttcaagcaggtgcggacagtaagcctgtatatgcattggaaggttctattgccgtg
gctggatcggccataaaatggctacgagaccaaatgacccttattgaagaatctgccgaa
atggatatcctcgccggatcagtgtcggacactggaggtgtctattttgttaccgccttc
tctggccttcttgcgccgtattgggatcgtgaagcttctggcactatcattggtcttact
ggatacacaacttctgcccacattgcgcgggccacccttgaggctgtgtgtttccaaact
cgcgcggttttagatgtcatcgagaaagagagtggtagcaggctcgacacactcaaggtt
gatggtggtgtgaccaactcagacttggctatgcaattgcaggctaacatcggtggcttc
aacgttgcacgaccttcgatgcgcgagtctactgcgcttggttccgctttgctggccgct
catgctcttggtctgtttggttgggatctgacccgtccagaaactctcagtgaggtgaac
accgctggtgtccatacattcgagcccgagttggaggagaaagccagactgaagaagatc
aagggatggaataaggctgttgatagggccaagaaatggcatgacatcgacgatgaggac
gacgaagaagaagaatacgaaaacgaagccggatacgctaagatcatcgggtcggcttaa

DBGET integrated database retrieval system