KEGG   Cryptococcus neoformans B-3501A: CNBD3710Help
Entry
CNBD3710          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
cnb  Cryptococcus neoformans B-3501A
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 377 aa AA seqDB search
MSFRAPNLIRSAAGRRASQTLNLRSQVIRRRFATEGGPEITKPSSPRSSNTRYLLAGVGI
AAVGAAYYFYGTGRTAHDSANKADTVVRGAVATVEAKTGLRRGKDEYQKVYNRIAETLEK
EGYDDGSLAPVLLRLAWHSSGTYNKEDGTGGSNFATMRFKPEAEHSANNGLHVAREHMEK
IKQEFPWISYGDLWTLGGVCAVQESGGPTIPWRPGRIDGFEAQVTPDGRLPDASQAQDHL
RFIFNRMGFNDQEIVALSGAHAMGRCHTNRSGFEGPWTFSPVTFSNQYFALLRDEPWQWK
KWTGPAQYEDKNTKTLMMLPTDMALLKDKSFKKYVDIYADNEEKFFSDFAKAFSKLIELG
VPERQWAGEPWTLGTSD
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcagagctcccaatttgatacgatcagccgctggccgaagagccagtcaaact
ttgaacctgcgttctcaagttattcgacgacgatttgcaactgagggtggaccggagatt
accaaaccatcttctccacgatcttcgaacactcgttatctcctcgcaggtgtcggtatc
gctgccgtcggcgctgcatactatttctacggcactggcagaaccgcgcacgattccgcc
aataaagctgacacggtagtgcgtggagctgttgccacggttgaggccaagacgggtctc
cgaagaggcaaggacgagtatcaaaaagtctataatcggattgccgagactctcgagaag
gagggttacgacgacggttctttggcccccgtccttcttcgcttggcttggcactcctct
ggcacctataacaaagaggatggtactggaggatcgaactttgctaccatgaggttcaag
cccgaggccgagcacagcgcgaacaatggcctacatgttgccagggaacatatggaaaag
atcaagcaagagttcccctggatctcttacggtgacctatggaccctcggtggagtctgt
gctgtccaggagtcgggcggacctaccatcccttggaggcctggcagaattgacggcttc
gaagctcaagtcactcccgatggtaggctaccggatgcctctcaagcccaagaccatctg
aggttcatctttaaccgcatgggcttcaatgaccaagaaattgttgcccttagcggcgct
catgccatggggcgatgtcatactaatcgatcgggctttgagggcccttggactttctcc
cctgtcaccttttccaaccagtactttgctcttctccgagacgagccttggcagtggaag
aagtggaccggacctgcccaatatgaagacaaaaacacaaagaccttgatgatgcttcct
acggatatggcgctcctcaaagacaagtccttcaagaagtatgttgacatctatgccgat
aacgaagagaaattctttagcgacttcgcgaaagcattctccaagctcattgagcttggt
gtccctgagaggcaatgggctggtgaaccttggactttgggaaccagcgattaa

DBGET integrated database retrieval system