KEGG   Cryptococcus neoformans B-3501A: CNBD3910Help
Entry
CNBD3910          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:cnb01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cnb00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:cnb00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cnb00620]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 479 aa AA seqDB search
MLSFAQVAKRSAAVSFRRQAVASRTLRTSAPSNVLSKFAMPAMSPTMTEGGVAQWKKKEG
ESFSAGDVLIEIETDKATIDVEAQDDGIMAKIIAQDGTKNIAVGTPIAIIGEEGDDLSQA
DALAAESQSESAPSQKEAAPKEEKTAPKEEKSESSTTPAVGVPGEQKSGAGDAQTSPAKA
PEHPSKGDRPKFFASPLARKIALENGIPLAEIKGTGPNGRIVEADVKNYKPSAAAASTPA
AGKSAAVPADYEDIPTSNMRRTIGKRLTESKQQLPHYYVTVEVNMDRVLKLREVFNKAGE
SKTKLSVNDFIVKAASLALADVPEANSAWLGETIRTYKKADICVAVATPNGLITPIIKDV
GAKGLATISAETKALASRARDGKLKPEEYQGGSFTISNLGMFGVDEFTAIINPPQSCILA
VGKTTTKLELAPEDPKGFKAVQVMKVTLSADHRTVDGAVGARWLKAFREYMEQPLTFML
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccttcgcacaggtggccaaacgctccgcagcggtcagtttcaggaggcaggcc
gtggcctcaagaactcttcgtacttctgcgccttctaacgtgctcagcaagttcgccatg
cctgccatgtctcctactatgactgaaggtggtgttgctcagtggaaaaagaaggaagga
gaaagtttctccgccggtgacgtgcttattgaaatcgagacggacaaggccaccatcgac
gttgaggctcaggacgatggtattatggccaagatcattgctcaagatggtactaagaac
atcgctgtcggcacccctatcgccatcattggtgaagagggtgatgacctctctcaagcc
gatgccctcgccgcggagtcccagtctgaatctgctccttctcagaaggaagcggctccc
aaggaagagaagaccgctcccaaggaggaaaagtctgagtcttcaaccacccccgctgtc
ggtgtccctggtgaacagaagtctggtgctggtgatgcccaaacatctcctgctaaggct
cccgagcaccctagtaagggcgacaggcccaagttcttcgccagtcccctcgctaggaag
attgctttggagaatggtatccccttggctgagatcaagggtactggacccaatggcagg
atcgttgaggccgatgttaagaactacaagccttctgccgccgccgcttccactcccgcc
gcgggcaagtccgctgctgtgcctgccgattacgaggatatcccaacctctaacatgcgc
agaaccattggcaagcgattgactgaaagcaagcagcaattgcctcattactatgtgact
gtggaagtcaacatggaccgagtgttgaagcttagagaagtattcaacaaggccggtgaa
agcaagacaaagctatctgttaatgactttatcgtcaaggctgcgtctttggctcttgcg
gacgtccccgaggctaactctgcttggcttggtgagactatccgcacctacaagaaggcc
gacatctgtgtcgctgtcgctacccccaacggtctcattacccccatcatcaaagacgtc
ggtgccaagggtcttgccactatttctgccgagaccaaggctcttgcctcccgtgctcgt
gatgggaagctcaagccggaagagtaccaaggcggctctttcaccatttccaacctcggc
atgttcggcgtcgacgaatttactgccatcatcaacccccctcaatcttgtatccttgct
gtcggcaagaccacaactaaactcgagcttgctcctgaagacccgaagggcttcaaggcc
gttcaggttatgaaggtgactttgagcgctgaccacaggactgtggacggcgcggttgga
gcgaggtggttgaaggctttcagggaatacatggaacaacccctcacttttatgctttag

DBGET integrated database retrieval system