KEGG   Cryptococcus neoformans B-3501A: CNBD4410Help
Entry
CNBD4410          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
cnb  Cryptococcus neoformans B-3501A
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 1507 aa AA seqDB search
MTQYGETPSLPYARDESSTSQVQSAYPAYPAEAYEHQEAFVDEEDDFSADVDVGAALQYW
TALRHMGGKGKQKEESEEDRTSKSPWRLRSKLKTVTAGLFICLNLGVDPPDIVKTNPCAK
TECWIDPTQLPAPKAIDAIGRNLHQQFETLNPKVKYKAFLDPSIEDTKKNCISMRKTTKD
ERVVFYYNGHGVPRPTPSGEIWVFNKNYTQYIPVSLYDLQEWLGSPCIYIWECSAAGNIL
NNFIKSAERRDTEARHAAAQAGHEDLPRTSYTEALHLAACKANQILPMSPDLPADLFTCC
LTSPIETALRHFVLQDPLRRNTGLSPDDPRSRITVDLAMRIPGDLKDRRTPLGELSWIFT
AVTDTIAWLSFPRDMFNKLFRQDLLVAALFRNFLLAQRIMSAYHCTPTSIPEIPDTHNHP
LWESWDLAVDACLAQLPGIFDQLGEPEPGKPLTIPPGMYKPSTFFAQHLQAFEVWLQHGA
TVSNKRSGRNRNDVVPRSPPEQLPIVLQVLLSQSHRLRALILISRFVDLGPWAVHLSLSI
GIFPYVQKLLASPAIELKPVLIYIWARILAIDQSCQIDLLRDSGFTYFTQILAAYPQQGS
LVIPNANEHRAMSSFILSILCRDFRQGQTACLNTHVFDACVARLHEDDWLLKTWCLLCIG
QLWADYDEAKALFWQSQRQGELLSALRSTSVEVRAAALYAFGTLLGASAISIETPAKGGG
GTGAQIGLSDVQQLELEAGVAFACMMSVKEDASPLVRKELVVVISCVVREWRGWLVCAAW
VYYEQEAALVAAEDDKPMPKDVVSDTLEQWTMNEDKHPEEHQHNLTLLSSFKVLFETLLD
LSVDPHTEVALTASTVVDYIIALLMDSPFVRVEGSAIRSIIRQHSRPRNATRQSSTTQLE
RSKLSHLNGVPPNLTRTSTDLDKSAADSTSSLKRNSSVANALRSLASITGFSAPETQSEE
PLSTEPRQEIPTAPDLSTSAYISPYPEAGHERVQPDSHPASTSSTGRNPSSLKYLNTHMS
TRSSLGILPSRLDQTPVEAYQVLEALTEEDMERLRMRRMRGREAGGDMDGRYGNNGLARS
TDLGLGMVAKEVKDDVLPLRSGYFDWAMDYFKTPQMKAPDADEPGSQTYNEQAWKHQRNE
QMVERSRANEEFAATHSWNMEAGTLHNDAWPLQLAFHSYDPVLAVTDDTDKICLWDWQNK
VKLNKFSNQNIGGSSISSIHFVNEMASSLMLTASTEGSIRIFRDYETPGETALASTFRAV
SETYPVAHSSGLLTAWEQQKGHLLVGGDMKVVRLWDATVERHLRDIATQAGSNLTAISSD
EPDGNVFVAGFGDGVVRLFDKRAEDAGEVVLRTWRQHKIWIQSVHLQKGSMRELVSGSMD
GEVRVWDVRKPDEPLYTLPRRNEGLMALAVHTGAPVLARTTAITPYSTKQDLEITGFKNP
LQPRRLAKISIPVPPAYNTPRHRAVDFLPSSASLVFHPVEMVVAAGGFDTSGTVKLYRCP
APDLPLG
NT seq 4524 nt NT seq  +upstreamnt  +downstreamnt
atgacccagtacggagagactccttccctcccctacgcccgtgacgaaagctcgacgtct
caagtccaatcggcctacccggcttatcccgccgaagcttacgaacaccaggaagcattt
gtggatgaggaggatgatttctcagccgatgtcgatgtcggggcagcactgcagtactgg
actgctctaaggcacatgggcggtaaaggaaagcagaaagaggaatcagaagaggacaga
acgagcaaatcaccctggcgtctcaggtcaaagttgaaaaccgtgacagccggtctgttt
atttgcctgaatcttggagttgatccccccgacatcgtaaagaccaatccatgtgctaag
acggaatgctggatcgacccgacgcagttgccggcacccaaggctatagatgccattggc
agaaatctgcatcaacaattcgagactttaaatcccaaggtcaaatacaaggcgttcctc
gatccgtctatcgaagacaccaagaagaattgcatcagcatgaggaaaactaccaaggac
gagcgtgtggtcttctactataacgggcatggcgtccctcgtccaactccttcaggagaa
atctgggtattcaataaaaactatacccaatacattcccgtcagcctgtatgacttgcaa
gaatggcttggatcgccatgtatctatatttgggaatgctcagcggcgggcaacatcctc
aacaactttattaaatctgctgaacgtcgtgatacagaggcccgtcatgctgccgctcaa
gctggtcacgaagatctcccccgtacctcctacactgaagcactccatctcgcagcttgc
aaagccaaccagattcttcccatgtctcccgatctccccgctgatctcttcacctgttgt
cttacgtctcctattgaaacagctcttcgccattttgtccttcaggatcctttacgaagg
aatactggcttaagtcctgatgacccaaggtcaaggataacagtggaccttgcaatgagg
attccgggggatctgaaggacaggagaaccccactgggagagctgagctggatattcacc
gcagtgacagatacgatcgcgtggttgtcgttccctagagatatgttcaacaagctcttc
cgacaagatcttctcgtggctgctctgttccgcaatttcttgctggctcaaagaatcatg
tcggcttaccattgcacacctacatcaatcccagaaattcccgatacacataatcatcct
ctctgggagtcatgggatctagccgtcgacgcgtgcctcgcccaacttcctggaatattt
gatcagctgggtgaacctgagccaggaaagcctttgacgattcctcccggaatgtacaaa
ccatcgacattctttgcccaacatctgcaagcatttgaggtctggctgcaacacggtgcc
acggtttcaaacaagcgatcaggtcggaatcgcaatgatgttgttccacggtcaccacct
gagcaactccccattgttttgcaggttctgctttctcaatcccatcgtttacgggccctt
attcttatctcacgattcgtcgatctcggcccttgggctgtccatttgtcgctttcgatc
ggtatctttccctacgtccagaaacttcttgcttctccagccatagagttgaaaccggtt
ttaatctacatttgggcgcgaattttggccatcgatcagtcatgtcaaatcgatctcttg
cgtgactctggcttcacctatttcactcaaatccttgctgcctaccctcaacaaggctct
ttagtcattcccaacgccaatgagcatcgcgccatgtcgtctttcattctaagtatactc
tgtcgagactttaggcaaggacagactgcgtgtcttaacacccacgtctttgatgcatgc
gtcgcgcgattgcacgaggacgactggctgttgaagacctggtgtcttctttgcatcggc
cagctctgggctgattacgacgaggcaaaagcactgttttggcagtcgcagcgacagggc
gagctcctctctgctctacgaagcacatctgtggaagtacgtgctgctgctctgtatgct
tttggtactcttttaggcgcatcagccatctcgattgagactcctgcgaagggaggggga
ggaactggcgcccaaatcggtctttctgacgttcaacagttagagttggaagccggtgtc
gcattcgcgtgtatgatgtctgtcaaagaggatgccagccctttggtccgcaaagagctg
gttgttgtaatcagctgcgtagtgcgagagtggaggggttggctggtctgtgccgcttgg
gtatactacgagcaggaggcggccttagtcgccgctgaagatgacaagcccatgcccaag
gatgtagtgtccgatacgcttgaacaatggacaatgaatgaggacaagcatcctgaagag
catcagcacaacttaacgctgcttagcagcttcaaggtgctttttgagacattgttggat
ttgtctgttgaccctcatacagaggttgccttgacagcctctactgtggtcgattatatc
attgctcttcttatggactcgcctttcgtccgagtggaaggttcggccattcgcagcatc
atcaggcaacatagccgaccacgaaatgccactcgtcagtcgtctactacccagcttgaa
agaagcaaattatcccatcttaacggtgtacctcccaatctcaccagaaccagcaccgat
cttgacaaatctgcggctgacagcacttcatccctaaaacgaaacagttctgtggccaac
gctctgagaagtcttgcgtccataaccggttttagtgctcctgaaactcagtctgaagag
ccattgtctactgaaccccgacaagaaatcccgactgctcctgatctctccacttcggcc
tacatttctccttaccccgaagctgggcatgagcgtgtccagcctgattctcatcccgcc
agtacatctagcactggacgtaacccctcttcgttgaaatacctcaacactcatatgagc
acccgctcttcgcttggaattcttccttctcgactagatcaaacgcccgtcgaagcttac
caggtcctcgaggcgcttacagaagaggatatggagcgtttgagaatgaggaggatgaga
ggcagagaggctggtggagacatggatggacgttatggaaataacggtttggctagatca
acagatttaggattagggatggttgcaaaggaagtcaaagatgatgttttgccgctgaga
agtggatattttgactgggcaatggactattttaaaacgccacagatgaaggcgccagac
gcggatgagccgggtagtcagacttataatgaacaggcgtggaagcatcagagaaatgag
cagatggtcgaaaggagtagggcaaatgaagagttcgccgccactcattcttggaatatg
gaagccggaacattgcacaatgacgcatggccacttcagttggcatttcattcttacgac
cctgtgttggcggtcactgacgacactgacaagatctgtctttgggactggcaaaataaa
gtcaaactcaataagttcagtaatcaaaatatcgggggaagcagcatctcgtcaatacat
ttcgttaacgagatggcatcatctttgatgttaacagcgtcgaccgaaggaagcattcgt
atcttccgtgattatgagacacctggcgaaacggcactcgcatcaacctttcgtgccgtc
tccgaaacctatcctgtcgctcacagcagtggtttgcttacggcctgggagcagcagaag
gggcacttactcgttggaggtgacatgaaggtcgtaagattatgggacgctaccgtggag
aggcatcttcgagatattgctacgcaagctggatctaatcttactgccatttcttctgac
gaaccagacggcaatgtgtttgttgcaggctttggtgacggtgtcgttagactgtttgac
aagcgtgcggaagatgctggggaagtggtgttgaggacttggaggcagcataagatctgg
attcaaagtgtgcacttgcaaaaaggaagcatgagagaattggtcagtggaagcatggac
ggtgaagtcagggtctgggatgtgagaaagccagacgagccactatatacattaccgcgc
agaaatgaaggtctaatggcgttggccgtgcacactggtgctcctgtgcttgctcgaacc
acggcaatcacaccatattcgaccaagcaagaccttgaaatcaccggcttcaagaatcca
ttgcagccccggagactggctaagattagtatccctgtgccacccgcgtataacacgccc
aggcatcgagctgtagattttttgccaagctctgcttcattggtcttccatcctgtcgaa
atggttgtggcagccggtggattcgatacatctggcacggtcaagctgtacagatgtcct
gcaccggatcttcctctggggtga

DBGET integrated database retrieval system