KEGG   Cryptococcus neoformans B-3501A: CNBD4990Help
Entry
CNBD4990          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     CNBD4990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 741 aa AA seqDB search
MLSAIDIVIITLTIALPLLFFFRESLPFIGGKTRAAAPHAAIANKASVDEGDPSDFVGKM
TRANKRCVIFYGSQTGTAEEYAIRLAKEAKSRYGLSSLVCDPEEYDMNMLDQVPEDACVI
FVMATYGEGEPTDNANAMMELLQEPEPEFSQGGSTLENLNYVIFGLGNRTYEFYNEVAKK
LDKRLTELGAKRIGERGEGDDDKSMEEDYLAWKDPMWTAFAERMGVEEGGAGDVPDFVVK
ELHDHSPEKVYHGELSSRALLASASGTNTPVGAYGVKNPYPAPVLSSKELFSVGGDRNCI
HIEFDITGTGMTYQHGDHVGIWPSNSDVEVDRMLAVLGLAASGRRQAIVDIESLDPALAK
VPFPTPATYDAIFRHYLDISAVASRQTIAFLARYAPSEAAREKLTRWGTDKEAYANEIDG
PALKLAEVLQSASSDSVEPPFESQTVWPIPFDRIVSSVPRLQPRYYSISSSSKLHPNAIH
VTAVVLKYQPTVSPPHHHEPRWVFGLSTNFILNVKMAHSGENTPVEGDVSHVSMKKVPSY
KLSGPRGHYVKENVYKVPIHVRRSTFRLPTSPKVPIIMIGPGTGVAPFRGFVQERIALAR
KAIDKNGPDALKDWAPMYLFYGCRRADEDFLYREEWPKYEQELKGVFRMKVAFSREMKKP
DGGKVYVQDLIHDLASELAPLILEKRAYIYICGDAKTMSKAVEERLMEMLGAAKGGSAAV
EGAKELKMLKERNRLMSDVWS
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgttgagcgcgatagacattgtgatcattacgctcacaatcgcgctccccctcctcttc
ttcttccgcgagtcgctccctttcatcgggggaaaaactcgagccgccgctcctcatgca
gccatagcaaacaaggctagtgtcgacgagggagaccctagtgactttgttggaaagatg
acaagagctaacaagcgctgtgtcattttctatggttctcaaactggtactgctgaagaa
tacgctatccgtctcgccaaggaagccaaatcccgttatggtctttcgtcccttgtctgc
gatcctgaagagtacgacatgaacatgcttgaccaggttcctgaggacgcctgtgtcatc
tttgttatggcgacgtacggcgaaggtgaacccacagacaatgccaatgccatgatggaa
cttcttcaagaacccgaacccgaattctcccagggcggcagcacccttgaaaacctgaac
tacgtcatctttggtctcggaaacaggacgtacgagttttacaatgaagttgccaaaaag
ctggacaaaaggttgaccgagctcggcgcaaagagaattggagagcgcggcgaaggtgat
gatgacaagagcatggaggaggactatttggcttggaaagacccaatgtggacggccttt
gctgagagaatgggtgtggaggaaggcggcgctggtgatgttcccgacttcgtggtcaag
gaattgcatgatcacagcccagaaaaagtttatcacggcgaactatcttctcgagcactt
cttgcctcggctagcgggaccaacacacctgttggagcgtacggcgtaaaaaatccttac
cctgcccctgttctctcgtccaaagagctattctctgttggcggcgacaggaactgcatt
cacatcgagtttgatattactggcactggtatgacctatcaacatggtgaccatgttggt
atctggccttccaactctgacgttgaagttgaccgtatgttggctgtccttggtcttgcc
gcatctggccgtcgtcaggctattgttgatattgagtccctcgaccccgccctcgccaag
gtgccttttcctactcctgctacttacgatgctattttccgtcactacctcgacatctct
gctgttgcttcccgtcaaaccatcgcgtttctcgctcgatacgctccttccgaggcagct
cgtgagaagctcactagatggggtactgacaaggaggcatacgccaatgagatagacggt
ccggctctcaaacttgccgaagttctccagtctgcctccagcgactctgttgaaccccct
ttcgagtcacaaaccgtttggcctatcccctttgatcgcattgtgtcttcagtccctcgt
cttcagcctcgctactactcgatctcttcttcttcaaaacttcaccctaatgccatccac
gttaccgcggttgtactcaagtaccagcctacagttagcccgcctcaccaccacgagcct
cgatgggtgtttggcttgtctaccaacttcattctcaatgttaagatggctcactctggc
gagaacaccccagttgagggcgatgtctctcatgtctccatgaagaaggtgccatcgtac
aagctttctggtccccgaggtcattatgtaaaggaaaatgtttacaaagtgcccattcac
gtgaggcgaagcacctttaggctccctacttctcccaaggtgccaatcatcatgattggt
cccggtactggtgttgctccgttccgcggctttgtacaagaacgcattgctctcgctcga
aaggcgattgacaaaaacggtcccgacgctctcaaggattgggccccaatgtaccttttc
tacgggtgtcgccgagccgacgaggatttcctgtatcgcgaagagtggcctaagtatgag
caagaactgaagggtgttttcaggatgaaagtggcgttttcaagagagatgaagaagccc
gatgggggcaaggtatacgtgcaagatcttatccacgaccttgcttccgagctcgctccg
cttattttggagaagcgtgcttacatctacatctgcggtgacgcaaagaccatgtccaaa
gctgtggaagaaagactgatggagatgttgggtgcggcgaagggtggcagtgcggccgtg
gaaggtgccaaagagttaaagatgctgaaggagaggaacaggttgatgagcgatgtctgg
agttag

DBGET integrated database retrieval system