KEGG   Cryptococcus neoformans B-3501A: CNBD5060Help
Entry
CNBD5060          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    CNBD5060
Enzymes [BR:cnb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     CNBD5060
Glycosyltransferases [BR:cnb01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   CNBD5060
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 767 aa AA seqDB search
MSLAPRKRRTDRNESPSLPVRSYSDDDKQRTPKPPLSAPYLRHEYIISWSTATALTVVAC
IVRFWRIAHPDQVVFDEVHFGSFAAQYIKREYYFDVHPPLAKMLNGLAAWFVGFDGNFGF
DQIGDSYTEASVPYVGMRSFCAILGTLTIPVVYAIMRESGYPVGIAAFSAALILFDNGHI
TQTRLILLDAHLVLFMALSLFCYVKFHQYRYQEFSRAWWGWLLATGFWLACTLGCKMVGL
FTFATVGAAVIWDLWEILDIKKGHSMSYWTRHFCYRAIGLVIVPFFVYLSFFWVHFKILK
FSGPGDSFMSPAFQETLEGNELLLNAQEIRYYDTISLRHKDTKQYLHSHEERYPLRYDDG
RISSQGQQVTCYPHNDTNNHWQVIPTKEIPESGRGRIVRHNDVIQLKHVNTQTLLLTHDV
ASPLMPTNQEFTTVSPDKEDKRNDTLFKMVLDDAHDGEAWKTLSGHFRLIHVPTKVALWT
HPKALPEWAFGQQEVNGNKNAAERSTLWFVNDIVEDGQGFDFKNRTVHVEPKAVKKRAFI
KKWFELQVLMLQHNAGLTSTHPYQSTPIEWPFCLSGISFWTRNEGQQQIYMIGNLLAWWI
CAVSVSVYVGVVAADMLARRRGIHPIEDGVRNRLYRNTGFFLGAWAFHYFPFYLMNRQRF
LHHYLPAHLASVLVAGSVMNFILIEAVNYPISIAGPTTRLRPAVRAKLNKSAKMVIAGLL
VVVIGVYLFLSPLTYGQSMTGEEVNRRKLLSTWSLHFEAKKTHSMDE
NT seq 2304 nt NT seq  +upstreamnt  +downstreamnt
atgtctctcgctcctcgcaagaggcgcacggacaggaatgagtccccatctctccccgtc
aggtcttacagcgacgacgacaagcaacgtactcccaaaccacccctttcagccccatat
ctccgtcatgagtacatcatatcttggtcaacagcaaccgcattgaccgtcgtcgcctgt
atcgtccgattctggcgcattgcccatccggaccaagtcgtctttgatgaagtccacttt
gggtcctttgcagctcaatacatcaagagggagtattatttcgatgttcatccacctctg
gcaaagatgttgaatggtttggcggcttggtttgttgggtttgatgggaactttgggttt
gatcaaattggcgatagctatacagaggctagtgttccctacgttgggatgagaagcttc
tgtgcgatcctcggcactctcacgatccccgttgtttacgccatcatgcgagaatctggc
tatcccgtcggcattgctgctttttctgcggctctgatcctatttgacaacggccacatt
acccagacccgactcattctccttgacgcccatctcgtcctcttcatggccctttccctt
ttttgctacgtgaaattccaccaatacagatatcaagaattttcccgggcttggtgggga
tggttgcttgccactggattttggctggcttgtactttgggatgtaagatggtgggcttg
ttcacctttgcgacagtcggcgctgctgttatttgggacttgtgggagattttggacatc
aaaaaggggcattctatgtcctactggaccaggcatttctgttaccgtgccatcggactg
gtaatcgtaccattcttcgtttacctgtctttcttctgggtgcacttcaagattctcaag
ttttccggtcctggtgacagttttatgagccctgctttccaggaaactctggaagggaat
gagttgctgttgaacgctcaagaaatccgatactacgatactatctctttacgccacaag
gacacgaagcaatacctccactctcacgaagaacgataccctttgaggtatgatgacggc
cgtatcagttcccaaggccagcaagtcacttgctatccccacaacgacaccaacaaccac
tggcaagtcatccctaccaaggaaatccccgagtctggtcgtggcaggatcgtgcgacac
aacgatgtcattcaactgaagcatgtcaacacgcagaccttgttgcttacgcacgatgtg
gcttcacctcttatgccgaccaaccaagagttcacgactgtttctcccgacaaggaagac
aaaagaaacgataccttgttcaaaatggtgctcgacgacgctcatgatggtgaagcgtgg
aagaccttgtctgggcactttagacttatccacgtacctacaaaggtcgctctttggaca
caccctaaagcgcttcctgagtgggcattcggtcagcaggaggtgaacggcaacaagaat
gccgccgaaagatcgactctctggtttgttaatgacatcgtggaggatgggcagggtttc
gacttcaagaaccgtacggttcatgtcgagcccaaagccgtcaagaagcgtgcattcatc
aaaaagtggtttgagctccaagttcttatgcttcagcacaatgcgggtcttacttccact
catccttaccagtctacacccatcgaatggccgttctgcttgagtggtatcagtttctgg
acacgtaatgagggtcagcaacaaatctatatgatcggaaacctccttgcttggtggatc
tgtgctgtctctgtgtccgtctacgtcggagttgtcgcggcggatatgcttgcgaggagg
cgaggaatacatcctatcgaggatggtgtacgaaaccgtttgtatcgcaatactggattc
ttcctcggggcctgggcgttccactactttccgttctatctcatgaatcgacaacgtttc
ttgcaccactaccttcccgctcatcttgcttccgtcctcgttgccggctcggtgatgaac
tttatcctcattgaggctgtcaactatcccatcagtattgccggtccgaccacaagactg
cggccagcagtgcgtgccaaactgaacaaatcagccaaaatggtgattgctggtctgctt
gtcgttgtgatcggagtgtatctcttcttgagtccattgacgtatggccaatcgatgact
ggagaagaggtgaatcgacgaaaattgttaagtacttggtcattacattttgaggccaag
aagacgcattcgatggatgagtga

DBGET integrated database retrieval system