KEGG   Cryptococcus neoformans B-3501A: CNBE0090Help
Entry
CNBE0090          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNBE0090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 2076 aa AA seqDB search
MRGDMMAGLSQPLVAQLFMSRALIWNCYVKLIKKLHENWAPKHSITDIMSTLPIQQWDPD
QFSDLQHILARVLTQPTTSSLRKLYATLEQARPWLLNLTALPGVNDKDKQFVEKKLANGT
SINVTGDLLNATNALSSFLSLSHLFSSILSLQAETHRAVYPSRSTPEISIYLLHRWQTDL
LDFLKELLKVVLEQGDMMGSGWEGLKEFVEDLLGAKVTLADGGGKEGTLVDQILSQLSIL
QTKISSLLSTSSSGQGYELQQFRLTALRAEQNKLAGILALIAEGGRLGRGQVIRVLKWLA
KVERMDAVVGLVAASVWAAWKPLEVLDASDARYDVSLSFRVSIRMRTELMEEEKVAEDWC
HDIKFLKLASSLALQERWAIPRLRESIKLSWSLFYLSCIKHDPSVIQTGIDQHEMEGWLL
DSIANGAFQFLHELVISIRQERGWDEPDEVKEAGTDSLVKVALASDKGNDEFLFRQLQDI
VDILAGKKQFLRNLRNREEDALIRRSSIALSHTNPNADANVYNYQTFLRLFASVYRSLPP
DSALDLWGNPTFTGTILDTRGGFPGPAFWEMLSSISSGPSCAAISYERLKDTRLPWTALF
KFYQHYIDIMPHAYEPIKTTRNPPPSLDPMPMEEVEICKGWTEVLSTVVKWSPAARGALL
QMKPHPLGVLWDFVNCENVPLHLKAAILNAITAFTSRPSQSQSEGSVTTHDPMDDEVLVQ
SVGFYEKISYRDPNADVRYLEGGRIPAPVGWLIRMGFLEGEAGRYELSRAYVNFLTALLP
SPSSSSSSSTSGTVSISSTLGKPTLSSTRPRLSNTLRRGTFQVIDGILLSLKMRRYTRDS
ERWEVLDGLTAFLERAVLGFDMSELLNLGSGSGSSSSASSVGGTGGSGRGIGQIALELSE
EPGFIVILRLLSERDIFAVLAEVLDSAASLGGNRERKKIVSKVLRQVLRIYHRVMELQLV
FADVLLLALTDPSRNPVHTLKRPYGLQPLDNHLLAHLTNVNNIALLIGDDDPMISYLSTK
LIALLSNSPVFNRSDLFQGEYKGEVNRLAGVLDVSDDSIRILQGFVRRLDVESEDPEQGV
EAVEEIALHGDIEQVKEELPMVIRSVILDILIDGTSSSNTSPNIAHFLLGYDFRHRQFSF
SSEEGCLQVVLKQMLEGAGLAGSTGEGDGILEIHPQLGAKSAELVYQLFSGVLTGRATLA
YAMSVTGYSARQLASLPRQCPEWQGLVPQGSSLSAPSISTTGMGWAVTRDTKVETSSETL
VAYLEFQRWIISSASLEIFTYDGHGASASRIAQILFNGQTQALSDSGDVGDGEGENRLPP
LLIDLLNSVDVQWVEEPIDNRQLEFYASFDFDAYKRPDVDWWDIKGLGAGLTAFKKQLEG
QGAITQASIPGVDAEAEYVLRRLGGKNRETDVAIAKGNFLAAWNELLKVGLTLLFARHIT
EDHQEAILFDLLEGLLARLDGEIDLAPGVEDLLCESSLVVMTTLVGVLQKFEGVNLPVEQ
LGAVLAKVVDAATRPGSTETARGNLYAAITQYLQLIIPANSNIPDDRSISGSTVDPLASF
SSTTMLQRITLQIFAAKKERLVPGLCRDAMDDRDVWKTQCFALLGGVVSICQGERDRHVV
APLISNGYLPLFVRSVKEREGALMECLAPDAENLHAYWVFEAKIAFLIALASTRKGSEDL
LDAGIFEIFATCGFINIQLNEGMLDEYAGGEIVERQHRVLVASLQLLTRVLSSLHKSARS
GAGHAISFLNAHREAILALVREPQRNLTVTALDECRLVVSILAMVVHKVSPEDLYSPSSF
GAFHLAVLSAAAHAFDKNTWVEIAEENSKIESQMVLLNQVLLAFLTAATNGLKAGSGNPV
FITGVQRSHGSAVKYIASAPSLQMAVNLLSDLAETTEEVSNQYEVILDRMQDGSDLEEED
VEKLRNEFIGDAPLSDDLIKVAFIARSQMLFNMIESLLLLIWRHLLFYANDVRGSLAPIR
PENLSPSLSSFAMSQQAQMEASRSNAGTMKMLERVAAGLRGTLIRLDDMEVNLELRRLAT
GGGARGDAYSGMLVRRLKEIVGGLVGEREIMEEDQQ
NT seq 6231 nt NT seq  +upstreamnt  +downstreamnt
atgagaggagatatgatggcgggcttatcgcaaccgctcgtcgcccaactttttatgtca
cgtgctttaatttggaattgttacgtaaaactcataaagaagctgcacgagaattgggct
cctaaacactcaatcactgacatcatgtccaccctacccatacaacagtgggatccagac
cagttctcggatctgcaacatatactcgcccgcgtactcacacagcctaccacttcctcc
ttgcgaaaactgtacgcaactcttgagcaggcgagaccatggttgttgaacctcactgct
ttgccgggcgttaatgacaaggataagcagtttgttgagaaaaagcttgccaacgggacg
tcaataaacgtcaccggcgacctcctcaacgcaacaaacgccctctcatccttcctctct
ctttcacacctcttctcctccatcctctctcttcaagcagaaacacaccgcgccgtctat
ccttcacgctccaccccggagatttcgatctacttgttacatagatggcagaccgattta
ctcgattttttaaaggaactgttgaaggtagtgttggagcagggggatatgatggggagt
gggtgggaggggttgaaggaatttgtggaagatttgttgggggcgaaagtgacccttgca
gatggcggtgggaaagaggggaccttggtagaccagatactcagccaactatctattctt
cagacgaaaatctcttccctcctgtccacttcgtcttcgggacagggatatgaactccaa
caattccggcttacagctctccgagctgagcagaataagttggcagggatacttgcgttg
attgcggaaggaggtagattggggaggggccaggttataagggttttgaaatggttggcc
aaggtggaaaggatggatgctgtggtgggtttggtggcagcgagcgtttgggcggcgtgg
aagcccctggaagtgctggatgcgtcggacgcgaggtacgatgtgagtttgtcttttcgt
gtttcaatacgtatgagaacggagctgatggaggaggaaaaggttgccgaggattggtgt
cacgatatcaagttcctcaagcttgcctcgagtcttgcccttcaagaacgatgggcgatc
cctcgtcttcgagaatccatcaaactctcctggtccctcttctatctatcctgcatcaaa
cacgaccccagcgtcatccagacaggtattgatcaacatgaaatggaaggatggttgctt
gactctatcgccaacggcgcattccaattcctgcacgagctggtcatctccattcgccaa
gaaaggggctgggatgagcctgacgaggtgaaggaggctggcacggattcgcttgtcaag
gttgcgcttgcgtcggataaagggaatgacgagtttttgtttaggcagttgcaggatata
gttgatatcctcgccgggaagaagcagtttttgcggaatctacggaatagggaggaagac
gctttgattcgacgatcgtctattgctctttcacacacaaaccctaatgccgacgccaac
gtttataattaccaaacttttctccgcctctttgcttcagtctaccgctccctccctcct
gattctgctctcgatttgtggggaaatccaacgttcaccggcacaattctcgatactcgt
ggtggtttccccggtccagccttttgggaaatgttatcctcaatttcctctggtccttcc
tgcgcagccataagctatgaaaggctcaaagacacccgtctcccttggacagctttattc
aagttttatcaacattacatcgacatcatgccgcacgcttatgaacctatcaaaacaaca
cgtaaccccccgccatcgctagaccctatgccgatggaagaggtggagatatgtaaaggt
tggacggaggtcttgagcacggtggtgaaatggtcgcccgcagcgaggggcgcgttattg
cagatgaaaccgcacccacttggtgtgctctgggatttcgtgaattgcgagaatgtgcca
ctccatttgaaggcggccatactcaatgctatcactgctttcacttctcgcccttctcaa
tctcagtcggaaggctccgttaccacccacgatccaatggacgacgaagtccttgtgcag
tcagtagggttttacgaaaagatatcataccgcgatccgaatgcagatgtgaggtatctg
gaaggaggaaggataccagctccggtggggtggttgattaggatgggattcttggagggg
gaagcggggaggtacgagctgagtcgtgcttacgtcaattttctcactgcacttttacct
tctccctcttcctcatcgtcatcctctacatcgggaaccgtctcaatctcatccacatta
gggaaacctactctatcgtctactcgtcccaggttgagcaacactctgagacgcgggact
ttccaagtcatcgatgggatattactttcactcaagatgaggaggtatacgagggattca
gagagatgggaggtcctagatgggttgacagcatttttggaaagggcggtcctagggttc
gatatgagtgagcttctaaacctaggctctgggtctggttccagctctagcgcgagttct
gttggaggaacaggaggatcaggtagggggatcggacagatcgccctggaattgagtgaa
gaacccggctttatcgtcatcctccgtctgctaagcgaacgtgatatctttgccgtcctc
gcagaggttttggacagtgccgcttctttgggcgggaacagagagaggaagaagattgtg
agcaaggttttgaggcaggtattgaggatctaccaccgtgtgatggaactccaattggtc
tttgccgacgtactcctactcgctcttaccgacccttctcgaaacccagtacatactctg
aaacgaccgtacggccttcagccgctggataaccatctcctcgcacatttgacaaacgtg
aacaatatcgctttgttgataggcgatgatgacccaatgatctcgtacctttccaccaaa
cttatcgcgttgctctccaattctccagtgttcaatcgatcagacttgttccaaggggag
tacaagggtgaggtgaatcggttggcgggggtattggacgtttcggatgattcaatccgg
atattgcaaggatttgtgaggaggttagatgtggaaagtgaggatccggaacaaggtgtg
gaggcagtagaggagatagcgttgcatggggatatcgagcaggtcaaggaagaattaccc
atggtcattcgttcggttatcctcgacatcctgatcgatggtacatcgtcatccaacacc
tcacctaacattgctcatttccttctcggatacgatttccgtcatcgccaattctcattc
tcctctgaagaggggtgtcttcaggttgttttgaagcaaatgcttgaaggtgccggattg
gccggatcgacgggtgaaggtgatgggattttggagatacatcctcagttgggagcgaag
agtgctgaactagtgtatcagctcttctcgggagtgttgactggaagagcgacgttggcg
tacgcaatgtccgtcacgggctattcggcaaggcaactcgcctctttgccccgccagtgt
cctgaatggcaaggcctcgttccccagggcagttccctttcggccccctccatttccaca
acaggaatgggatgggctgtgacaagggatacaaaggtagaaaccagctctgagaccttg
gtggcctaccttgaattccaacgatggatcatctcaagtgcctctctggagatttttacc
tatgacggccatggcgcatcggcttctcgtatcgcccagattcttttcaacggccaaaca
caagccctttccgatagtggcgacgtaggcgatggtgaaggggaaaaccggctccctccg
cttttgatcgacctcctcaactctgttgatgtacaatgggtcgaagaacctatcgataac
cgccagcttgaattctatgcgtcatttgatttcgatgcttacaaacgaccggatgtggat
tggtgggatattaagggcctcggagctggtttgacggcgttcaagaaacagctcgagggg
cagggagcgatcactcaggcgtcgatcccaggtgtagatgccgaggcagaatacgtgctt
aggcgtttgggaggaaagaacagggaaaccgacgtagcgattgcaaagggcaacttcctt
gccgcttggaacgaattgctcaaggtgggattaaccttgctcttcgctaggcacatcaca
gaagatcaccaagaagctattctcttcgaccttcttgaaggtttacttgctcgacttgac
ggagagattgaccttgctcccggtgtggaggatctgttatgtgaatcgagcttggtggtg
atgacaacattggtcggcgtgctccagaagtttgaaggagtcaatcttccagtagaacag
ctcggagcggttttggcaaaggttgtagatgctgctacgaggccgggatcgacagaaact
gcaaggggaaacttgtatgccgcgatcacacaatacctccagctcatcatcccagccaac
tctaacatccctgatgatcgatccatttccggttcaacagttgaccctctcgcttccttt
tccagtactaccatgcttcagcgcataacgcttcaaatatttgcggccaagaaggagaga
ctcgtacccgggctttgtagagacgccatggatgatcgggatgtgtggaagacgcaatgc
tttgcgttattgggtggtgtcgtcagcatttgccagggagagagggataggcacgttgtg
gcgccgttaattagcaatgggtacctgcccttgtttgtgaggagtgttaaggaaagggaa
ggggcattgatggaatgtcttgcacctgatgctgaaaacctccacgcttactgggtgttt
gaggccaaaatcgcctttctaatcgctctcgcatccactcgcaagggttccgaagacctc
ctcgacgccggcatcttcgagatctttgccacatgcggcttcatcaatatccagctgaac
gagggcatgctggatgagtacgctgggggagagattgtcgagaggcagcatcgagtactg
gtggccagtctacagttgctcacccgagtgctgtcgagcttgcacaagtctgcaaggtca
ggagctggtcatgccataagtttcctcaacgctcaccgcgaagcgattcttgcgctcgtc
cgtgaacctcaacgaaaccttacagtgaccgcacttgatgaatgtcgattggtggtatct
attttggccatggttgtgcacaaggtttctcccgaggatctgtattccccgtcaagtttt
ggcgctttccaccttgctgtgttgtctgccgctgctcacgcttttgacaaaaacacttgg
gtcgaaatcgccgaggagaatagcaaaattgagtcgcagatggtacttcttaaccaagtc
ctgcttgccttcctcaccgccgccacaaatggcttgaaggctggatctgggaatcccgtg
tttatcaccggtgtacagaggagtcatggtagcgctgtcaaatatatcgcctctgctcct
tcactacaaatggccgtcaaccttctctctgaccttgccgagacgacggaagaggtgtct
aaccagtatgaggtgatccttgatcgaatgcaagacggaagcgatttggaagaggaggac
gtcgaaaagcttcgtaacgagttcattggcgatgcccccttatcagatgatttaatcaag
gttgcctttattgcaagaagccagatgttgttcaatatgattgagtcgctccttcttctc
atatggcgacatcttttattctatgccaacgacgttcggggatctcttgcccctatccgg
ccggagaacctctctccttcactcagctcattcgccatgtctcaacaagcacagatggaa
gcttcgaggtcaaatgcagggacaatgaaaatgctggaaagagtagcggcgggtctgaga
gggacgctgatacgattagatgatatggaagtgaaccttgaattgaggagactcgcgacg
ggcggaggtgcaagaggtgatgcatattctggcatgcttgtaaggaggttaaaagagata
gttgggggcctagttggtgaaagggaaattatggaggaggatcaacagtaa

DBGET integrated database retrieval system