KEGG   Cryptococcus neoformans B-3501A: CNBE0270Help
Entry
CNBE0270          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CNBE0270
Protein kinases [BR:cnb01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CNBE0270
Exosome [BR:cnb04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   CNBE0270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 401 aa AA seqDB search
MSTSTRRHVPDDKLANHKADPNAAANAGQVQERTTKGSSSSAPRKVRFNVGNNYHVVDVI
GEGAYGVVASAVHRPSGTKVAIKKIAPFDHSMFALRTLRELKLLKYFAEEGVSENIISVL
DIIKPPSYDTFKEVYLVQELLETDLHRVIRTQDLSDDHCQYFLYQTCRALKALHSAEIIH
RDLKPSNLLLNANCDLKVCDFGLARSTQTAFPAEGNNQGFMTEYVATRWYRAPEVMLSFR
MYTKSIDVWSVGCILAEMLSGKPLFPGKDYHNQLALILDVLGTPTIDEFHAITSKRSKDY
IRSLPFRKKRTFESIYPSANPLAIDFLRKTLTFDPRKRYTVEQCLAHPYLDAYHDPEDEP
SAKPLPPSFFEFDMMKDDISREELKRLLYEEIMGFRPVLEG
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacgtctactcgccgccatgtcccagacgacaagctcgccaatcacaaagctgac
cccaacgcagctgcaaacgctggccaggtgcaggagcgtacgaccaagggttcttcttcc
tccgcccctcgcaaagtcaggttcaacgtcggcaacaactaccatgtagtcgatgtcatt
ggcgaaggcgcctatggggtagtcgcttccgccgtccaccgcccatcaggtaccaaagta
gctatcaagaagattgccccgtttgatcattcaatgtttgcgttgagaacattgagagag
ttgaagttgttgaagtactttgcggaggaaggtgttagtgagaatattatctcagtgctg
gatatcatcaaaccaccttcttacgatacttttaaagaagtctacctcgtccaagaactt
ctcgaaacagatcttcatcgcgtgatccgaacccaagacctgagcgacgaccattgtcaa
tatttcttataccaaacatgtagagctttgaaggctttgcattctgctgaaatcatccat
cgagacttgaaaccatccaacctcttgctcaatgccaattgtgatctcaaagtatgcgat
ttcggactcgcacggtcgacacaaaccgccttcccggcggagggcaataaccagggattc
atgacggagtatgtcgcaacaaggtggtatagagcaccagaagttatgctttcgtttaga
atgtacaccaagtcaattgacgtatggtcagtggggtgtatactcgcagagatgttgagt
ggaaaaccccttttcccggggaaagattaccacaaccaactagctctcatccttgatgtg
ttgggtacacctactattgatgaatttcatgccatcacttcaaagaggtcaaaagattat
atccgatcgttgccattccgaaagaagaggacgttcgaaagtatttacccgagcgcgaac
ccgctcgctatcgatttcttgagaaagacacttactttcgatccccgcaaacggtacaca
gtcgaacaatgtctcgcccacccttacctcgacgcctaccacgacccggaagacgaaccg
tccgcgaaaccgctcccaccctcgttctttgagtttgatatgatgaaagatgatatttcg
agggaagagttgaagaggctgttgtacgaggagattatggggtttcgtccggttttggag
gggtag

DBGET integrated database retrieval system