KEGG   Cryptococcus neoformans B-3501A: CNBE0520Help
Entry
CNBE0520          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CNBE0520
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CNBE0520
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CNBE0520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 185 aa AA seqDB search
MTFFDSIASKFGYESLPGDVANKSFYDLKAKLPGSKGDLDFSTLKGKVVLIVNTASKCGF
TPQYTGLEELHKTYGDKGLVVLGFPSNEFGGQEPGSDDDIAQFCTLNHGVTFPLMKKSEV
NGKNMNEVFAWLKSQKGENVGGLAGTTAIKWNFTKFLINKEGKCVGRYGSSTKPEKLKEE
IEKLL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttttcgacagcatcgcctccaagtttggttacgaatctctcccaggggacgtt
gccaacaaaagcttctacgatttgaaggccaagctgcctgggagcaagggtgatttggac
ttttctactttgaaaggcaaggtcgtgttgatcgtcaacactgcttccaaatgtggtttc
actccccagtataccggccttgaagagctccacaagacttacggagataagggtctcgtc
gttcttggtttcccttccaacgagtttggaggacaagagcctggctctgacgatgatatc
gcccagttttgtacccttaaccacggtgtcactttcccgcttatgaagaagtctgaagtg
aacggaaagaacatgaatgaggtctttgcgtggttgaagtctcagaagggagagaatgtt
ggtggtcttgccgggaccactgctatcaagtggaactttaccaaattccttatcaacaag
gagggcaagtgtgtcggccgatatggctcttccaccaagcccgagaagctcaaggaggaa
atcgagaagcttctttaa

DBGET integrated database retrieval system