KEGG   Cryptococcus neoformans B-3501A: CNBE0520Help
Entry
CNBE0520          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cnb00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cnb00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 185 aa AA seqDB search
MTFFDSIASKFGYESLPGDVANKSFYDLKAKLPGSKGDLDFSTLKGKVVLIVNTASKCGF
TPQYTGLEELHKTYGDKGLVVLGFPSNEFGGQEPGSDDDIAQFCTLNHGVTFPLMKKSEV
NGKNMNEVFAWLKSQKGENVGGLAGTTAIKWNFTKFLINKEGKCVGRYGSSTKPEKLKEE
IEKLL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgacgtttttcgacagcatcgcctccaagtttggttacgaatctctcccaggggacgtt
gccaacaaaagcttctacgatttgaaggccaagctgcctgggagcaagggtgatttggac
ttttctactttgaaaggcaaggtcgtgttgatcgtcaacactgcttccaaatgtggtttc
actccccagtataccggccttgaagagctccacaagacttacggagataagggtctcgtc
gttcttggtttcccttccaacgagtttggaggacaagagcctggctctgacgatgatatc
gcccagttttgtacccttaaccacggtgtcactttcccgcttatgaagaagtctgaagtg
aacggaaagaacatgaatgaggtctttgcgtggttgaagtctcagaagggagagaatgtt
ggtggtcttgccgggaccactgctatcaagtggaactttaccaaattccttatcaacaag
gagggcaagtgtgtcggccgatatggctcttccaccaagcccgagaagctcaaggaggaa
atcgagaagcttctttaa

DBGET integrated database retrieval system