KEGG   Cryptococcus neoformans B-3501A: CNBE1550Help
Entry
CNBE1550          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11872  
ubiquitin carboxyl-terminal hydrolase 9/13 [EC:3.1.2.15]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CNBE1550
Peptidases [BR:cnb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNBE1550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 802 aa AA seqDB search
MSAFRKFVGNKNAGISASEGDQDPTDASLLPRANADEERLWGIENFSNSCFCNSVLQALY
ACSTFRDFVEAYPDILPPRRPIGPSQVEKRYPSVEWDGPVPGWDPSIRLNKEHRAFIALQ
EANTSMTPGGKEKRNWMGRKMSSAQSAPTLATLQASQPEPLPSLPNPFPNFDDPLLVRTP
ASDNDPPLTLFQTFQTLFYYFSHSPPHMPIKGKGQTKDSEGALIEYTEEEKVDDSGVEVP
EKASSSNQGQPAQSTSASSQQTQSQGQNAQSSGPSKLASLPPPSTFRETGAWRAGQLGWG
VVQPNDVMDAVKRSAPSFNNDDQHDAHEFFSVVVNTLAKEVDAVNEKLRAQGKEVAKMTA
PWAKTFVEALFQGITTSETKCLSCETISSRDEEFIDLSVDIEQHCSITSCLRQFSSDEMM
SGREKFSCESCSGHQEAKRSIRIKRLPPILAVHLKRFAHNESYRAIKLFYRVNHPTTLIP
PNTTDNCENPDQIYDLVAIMVHIGNGPVQGHYVTVKRTPSGRWVMCDDDNIEAIEENQLE
YWLGNRTQGQGYVLFYQARGITAEHVGLKVEKRKPNGVFEPVGEGVRYADGYGQAPAMAP
VASATLNNVRTVNGVREEEEEEVASSSGSISVSVPGLKPLSLASPVSSPSATPSSVGSRV
DRQLGFNTPANGVAHESTARPPLKKELSDKKWFRRMSMSGISSSAKDKEKTSNSKDKPVN
GLSNGGTTPLAECRTDTSSSADCHTLCPLLDGKGGKDTWKNIEVIAHSVELRSVREAGLR
CEMEERALAEKVKQVWLQRERR
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctttccgcaagtttgtcggtaacaaaaacgcgggcatatctgcatcagagggt
gatcaagatccaaccgatgcatccttgctaccgcgcgcaaacgccgacgaagagcgtctg
tgggggatagaaaacttctccaactcttgcttctgcaactcagttttgcaagctctatac
gcgtgttccacgttccgcgatttcgtggaagcttatcccgatatcctgccgcctcggcga
ccgattggaccttcacaggtggaaaaaaggtatcccagcgtcgaatgggatggcccagtt
ccgggatgggacccatccattagactaaataaggaacatagggctttcattgccctgcag
gaggcgaatacttcaatgactcctggcggaaaggaaaaaaggaattggatgggtcggaaa
atgtcttccgcacaatccgctccgacattggcgacccttcaagccagccagcccgaacca
cttccaagtttaccaaaccctttccccaattttgacgatcctctgctggtcagaacgcct
gcatcggacaatgacccgcctcttacattgttccagactttccagacgcttttctactat
ttctcacattctccgcctcacatgcccatcaaaggcaagggtcagacgaaggactctgaa
ggcgctctcattgagtataccgaagaggaaaaagtggatgattcgggtgtcgaggtgcct
gagaaagcctcttcatcgaatcaaggccagcccgctcaatcaacttcagcatcgtcgcag
caaactcagagtcaaggccagaacgctcagtcttcaggtccttcgaaacttgcctccctt
ccaccgccctccacatttcgtgaaacaggtgcttggcgagcaggtcagcttggctggggt
gttgtccagcctaacgacgtcatggatgctgtcaagcgctctgcgccatctttcaacaac
gacgatcaacatgatgcacacgaattcttcagtgttgtagtcaacactctcgccaaagaa
gtcgacgctgtcaatgaaaaattgagagcgcaagggaaagaagtggcgaagatgactgcg
ccctgggcaaagacatttgtcgaagcactatttcaaggtatcactaccagtgagacaaag
tgtctgagctgcgaaacaatatcttctcgagacgaagaattcattgatttgtctgtggat
attgagcagcactgctctatcacctcctgcctccgccaattttcctcagacgaaatgatg
tccggaagggagaaattctcttgcgagtcctgttctggtcatcaagaggcgaagagaagc
attaggatcaaacggctcccgcctatcttagctgtccatctgaaaagatttgcccacaat
gagagttatagagccatcaagttgttttaccgggtaaatcatcccacgactctgatccca
cccaacacaacagataattgtgaaaaccccgaccaaatttatgaccttgtggcgattatg
gtgcacattggaaacggtcctgttcaaggccattatgtaacggtcaagcgaacgccttct
ggtcgttgggtcatgtgtgatgacgataatattgaggccattgaggaaaatcaactagag
tactggcttggtaaccgcacccagggccaaggctatgtcttattttaccaggcgcggggc
atcactgccgaacacgtgggtttgaaagtggaaaagcgaaaacccaatggagtatttgag
cccgttggagagggcgtcagatatgctgatggttatggacaagctcccgctatggccccg
gtagcctcagctaccctgaataatgtcaggactgtgaatggtgtaagggaggaagaggaa
gaggaagtcgcctcgagttcggggtcaatttcagtctctgtacctggtctaaagccgttg
tcattggcttcgccagtctcgtcaccttccgctacacccagcagtgttggctcccgcgtt
gatcgccaacttggcttcaatacacccgcaaatggggtagcgcatgagtctacggcacga
ccaccactcaaaaaggaacttagcgacaaaaaatggtttcgtcgcatgtccatgtcaggt
atatcctcatctgccaaggacaaagaaaagacctctaatagcaaagacaaaccggttaat
ggcctttctaacggaggtactaccccccttgccgagtgccggacggacacgtcatcctcg
gcggactgccataccctctgcccgctcttggatgggaagggcggaaaagacacatggaaa
aatatcgaggtgattgcgcacagtgtggagttgaggtccgtacgcgaggcgggattgagg
tgcgagatggaggagagagcgctagcggaaaaagtgaagcaggtttggctacaaagggag
agaaggtag

DBGET integrated database retrieval system