KEGG   Cryptococcus neoformans B-3501A: CNBE1890Help
Entry
CNBE1890          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:cnb04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 621 aa AA seqDB search
MDNTVAPSKGKKPGGARPNPGTRPESGGPARPTGAGGVPKLSIPPDNVPGMHVDQAGQGG
WHQPSSLPSLALRPMRPSPTPSSSSRPKLSLTPLTPTIPASSSSAPSSASPAPPNRPALL
NAHSARGYGERNTPSLKLSIPGASSVGPGFSTEHDYPLELPDDTDALSSELKTPTPGRPA
GGGLNLSLSSLSLTSSEDANPTLQARGRDYDEGESSYGYGCVGNGLIGPGGDAISAMTED
IRQALSRNRFETGSDRGGARSRAGSLMSDSSRATAGRDRSDSASLYNAASRRESPSASLS
GGSARQSLDLPRAAEEVNEHKESPVFDPEGLVMMRRLGEGTGGSVDMVQDRATGRIMAKK
VITRTSNPMVHKQLLRELEILNSCASPFIVEHYGSFLADHDSSIGILMEYCEAGSLDSLL
GKMKKKSMRCSEHVLGRVASSVLKGLDYLHQRRIVHRDIKPSNILITRQGAVKLCDFGVS
GELVESLAGTFTGTSFYMAPERIQNKPYSIKADVWSLGMTLHEIAHLRFPFPPEGENQSV
APIELLSYIVTAPVPVMIDDLSVGRVWSEPIKDFMGQCLIRSGTDRPYPWQLLQHPFIVA
SEAKKVNMAKWVAALCNWPLS
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atggataatactgttgcgccatctaaaggcaaaaagcccggaggcgccagacccaaccct
ggcactcgacctgaaagcggtgggccagccaggccaaccggggcgggtggtgtgccaaag
ctcagtatacctccggacaacgtccccggtatgcatgttgaccaagcaggccagggagga
tggcatcagccctcctctcttccatctcttgctctccgtccgatgcgcccttctccaacc
ccttcgtcgtcgtctcgccctaaactatctctgaccccgcttaccccgactattcctgct
tcgtcaagctctgctccttcttcagcgtccccagctcctcccaataggccagcactcttg
aacgctcattctgctagaggatatggggagagaaacacaccaagcttaaaactttccatt
ccaggagccagctccgtcggaccgggcttctccaccgagcacgactaccctcttgaactg
ccggatgataccgacgcattatcctctgaactgaagacgccgacgcctggacgtcctgct
ggaggaggcttgaatctaagtctgtcttccctttcacttacatcttccgaagatgcgaac
cccacactacaagctcgcggaagggactatgatgaaggagaatcatcgtatggttacggg
tgtgtgggtaacggtctgattggacctggaggtgatgcgatcagtgccatgacggaggat
attagacaagcattatctcgaaaccggtttgaaactgggtccgatagaggaggagcgagg
agccgagcaggcagcttgatgagcgatagtagccgggctaccgcaggacgtgatcggtca
gattcggcatcactgtataacgcagcttcaaggcgtgaatcaccgtctgctagcctatcg
ggaggatctgcaagacaaagtctggatctaccgcgagcagcagaagaggtgaacgagcac
aaggaatcaccagtatttgatcctgaaggactggtaatgatgagaaggctcggtgaaggg
actggtggctcagtggatatggtacaggaccgagccacaggtcgcattatggccaagaag
gttatcactcgaacctcgaacccaatggtgcacaagcagctccttcgtgaactagagatt
cttaactcttgcgcttcgccgtttattgtggaacattatggatctttcttggcggatcat
gattcgtcaataggaattctcatggagtactgcgaagccggcagtctggatagtcttctg
ggtaagatgaagaagaagagtatgaggtgctccgaacatgtcctgggtagagttgcgtct
tcggtgttgaaaggtcttgattatctccaccaacggcggatcgttcatcgagacatcaaa
ccctccaatatccttatcactcgacagggggccgtcaagctttgtgattttggagtcagt
ggagagctggtagagtctttggcggggacttttactgggacaagcttttacatggcccct
gaaagaatacaaaacaagccttactcgatcaaggcggacgtttggtctctcggcatgacc
ttgcacgagatcgcccacctccgattcccatttcctcccgagggcgaaaatcaatcagtt
gcacctatagagttattgtcatacattgtgacggcacccgtaccggtaatgatcgatgat
ctaagtgtggggagggtgtggagcgagcctatcaaagatttcatgggacaatgcttgata
agatcgggaacagataggccctacccttggcaactactgcagcatcccttcattgtcgcc
agtgaagctaaaaaggtgaacatggccaaatgggtagcagccctttgcaactggcctcta
tcatag

DBGET integrated database retrieval system