KEGG   Cryptococcus neoformans B-3501A: CNBE2650Help
Entry
CNBE2650          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cnb00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 577 aa AA seqDB search
MASRTEMASDDLLSFEKSLFLPRNATPRPYISRTEHNCHRYRSVVIKGLFLCLLILSAIV
TSVSLGLWPHYLNSRSVLFDHWSGHQNVFLESRILANIGPGIGAKEGLVVASPSKGHGKE
PDYYYTWTRDSALTISTLIPHLRFDLADINNTTEPWELYSALSDVLKEYLFRDYIESQAE
IQIGKNPSGDLKKGGLNEPKFHVDGTPFTGNWGRPQRDGPALRAIAVMIYANFLLDRGFP
SDVSYVQQRIYDPRHLKSPGRVLKNDLEEVAQGWSKGGFDLWEEVDGHHLFTLLVSRKAL
YDGSTFAKRLNDVGAADHYLAQAHSITQKLSSFWDSKRGYWLSSLSGRDFELVQLKSEFN
FTNAYPRREWLDCSIPLSIIHAGSHTFQPRHNFSFPFSATDPSVLSTIHLYIKSFDGLYS
INDGKPWSDGWALGRYKEDVYDGKGQSQGNPWFICTFSVAHSLYLAYKEFREAGVIVIAN
QTVAFWEDVVSISSKPPKVREGDVWTEGEDWQFKEGMKCLKDVADRFMEVGQQVAAANGG
RMSEQIDRDDGQCRGARDLTWSYASLLDLIRVRSDLD
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcatcaagaacagagatggcatccgacgatcttctctcattcgaaaagagtctattc
ctacccagaaatgcgacgccgcgcccatacatttctagaactgaacacaactgtcacagg
tataggagtgtggtcatcaaggggctatttctctgccttctcatattatctgcgatagtt
accagcgtctctctaggactttggccccattatttgaattcgcggtcggtactctttgac
cactggagtggtcaccaaaatgtttttttggagtctagaattttggcgaatataggacca
gggataggcgcaaaggaagggcttgtagtggccagtcctagtaagggacatggaaaagag
ccagactactactatacctggacccgtgattctgctctaaccatttctacattgatacct
catttgagatttgatttagccgatatcaataataccaccgaaccgtgggagttatacagc
gccctgtctgacgtactaaaggaatatctctttcgggactatattgaaagtcaagcagag
atacaaataggcaaaaacccttctggtgacttgaaaaaaggtggccttaatgaaccaaaa
ttccatgtcgacggtacccccttcacggggaattggggaaggcctcagagagacggtcca
gcacttcgggccattgcggtgatgatttatgccaacttcctccttgaccgtggatttcct
tcagacgtcagctacgtgcagcaacggatctatgatcccaggcatctcaaatcaccaggg
agagtccttaagaacgatttggaagaggtagcacaaggatggtcaaaaggcggctttgat
ctgtgggaagaggttgatgggcatcacctattcacccttcttgtttcccgtaaagccctg
tacgatggttcgacatttgcgaaacgtctcaacgatgtcggagcagcggatcattacctc
gcccaagctcactctatcacgcagaagctttcatcgttttgggattccaaaagaggctat
tggctctcaagcttgagtggtcgcgattttgagcttgtgcagctcaagtcggaatttaac
ttcaccaacgcatatccaagacgagaatggctcgattgttcgatacccctgtctattatc
catgctggctcccacacatttcaaccccgccataatttctcttttccgttctctgcaact
gatcccagtgtcctttcgaccatacacctttatatcaagtcttttgatggactttacagt
atcaatgatggcaagccttggtcagatggatgggcgttagggcgttacaaggaagacgta
tatgatggtaagggccaaagtcaagggaatccttggttcatttgcactttttctgttgcg
catagtctgtatctcgcctacaaggagtttcgcgaggcaggtgtcattgtgattgccaac
caaaccgttgcgttttgggaagatgtcgtttcgatctcatctaaacctcctaaagttagg
gagggcgatgtttggactgaaggggaagactggcaatttaaggagggaatgaaatgtttg
aaagacgttgcagacaggttcatggaagttggccagcaagtggcggcagcgaacggggga
agaatgagcgaacaaatagacagagacgatgggcaatgcagaggggcaagggatttgacc
tggtcatacgcaagcttgttggatttgatcagagtgagatcggatttggattga

DBGET integrated database retrieval system