KEGG   Cryptococcus neoformans B-3501A: CNBE4080Help
Entry
CNBE4080          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K03245  
translation initiation factor 3 subunit J
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    CNBE4080
Translation factors [BR:cnb03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    CNBE4080
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5
AA seq 248 aa AA seqDB search
MSDDDWDADETIAPAAPAVTLPPKVPAKKWADEDAEDNDSDDDWDKSEDEKPQATKVAAV
APAKKKGTLKQKLAEKERLAKEAKEKGVDDDNDLMYTMTEQERRRLAREKEQEADLAVAS
DLMGAVDLGDEGDALKSVLSAHPSTKNDFSELSKNIYTSIIKKHESNPLYAHFVEQLAKD
ISAALTAVQTRKVSSALSVLGNTKQQEEREKASGKKKAASKPKLGAAKVLSKVDTEAYDD
VLGDDDFM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgacgactgggatgctgatgagactatcgcccccgctgcccctgctgtaact
ctccctcccaaggttcccgccaagaagtgggccgatgaggatgccgaagataatgacagt
gacgacgactgggacaaatctgaggatgagaagccacaggcgaccaaggttgctgccgta
gcaccagctaagaagaagggtactctcaagcaaaagcttgccgaaaaggagaggcttgcc
aaggaggctaaggagaagggagtggacgatgacaatgacttgatgtacactatgactgag
caagagaggcggcggttggctagggagaaagagcaagaagcagacttggccgtggcttct
gatctcatgggtgctgtcgacttgggtgacgagggtgatgctctcaagagtgttctttcc
gcccatccctctaccaagaacgacttttccgaactctccaaaaacatctacacttctatc
attaagaagcacgagtccaaccctctttacgctcactttgtcgagcagcttgccaaggac
attagtgccgcgcttaccgctgttcagactaggaaggtgtcttcagctttgagtgtgttg
ggtaacaccaagcaacaggaagagagggaaaaggctagtggaaagaagaaggctgcgtca
aagcccaagctcggcgctgccaaggtattatccaaggttgacactgaggcttacgacgat
gtccttggagatgacgatttcatgtaa

DBGET integrated database retrieval system