KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBE5000Help
Entry
CNBE5000          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00010  Glycolysis / Gluconeogenesis
cnb00051  Fructose and mannose metabolism
cnb00562  Inositol phosphate metabolism
cnb01100  Metabolic pathways
cnb01110  Biosynthesis of secondary metabolites
cnb01130  Biosynthesis of antibiotics
cnb01200  Carbon metabolism
cnb01230  Biosynthesis of amino acids
Module
cnb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cnb_M00002  Glycolysis, core module involving three-carbon compounds
cnb_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNBE5000
   00051 Fructose and mannose metabolism
    CNBE5000
   00562 Inositol phosphate metabolism
    CNBE5000
Enzymes [BR:cnb01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CNBE5000
Exosome [BR:cnb04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CNBE5000
  Exosomal proteins of bladder cancer cells
   CNBE5000
  Exosomal proteins of melanoma cells
   CNBE5000
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 4936512
NCBI-ProteinID: XP_775227
UniProt: Q55RN1
Position
5
AA seq 251 aa AA seqDB search
MARKFFVGGNFKMNGSLESVEKIVRSINDANLDGTNEVVIAPPALYLLKVQSELNAPTQV
SAQNAFTESSGAFTGEIAPQQLKDANVHWVILGHSERRSLFGDTDKLVADKTKAAINAGL
SVIACIGESLEERESDKTMTVVERQLEAIAAAIDVDAWKRIVIAYEPVWAIGTGKVATVS
QAQEVHAAIRSWLSRRASPEIADSTRIIYGGSVNGKNCGELSAAKDIDGFLVGGASLKPE
FIDICKSGKKA
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggctcgaaagttctttgtcggcggcaactttaagatgaacggctctctcgagtctgtc
gagaagattgtccgatccatcaacgacgccaacctcgacggcaccaacgaagtcgtcatc
gccccccctgccttgtaccttctcaaagtccagtccgagctcaacgcgcccacccaagtc
tctgcccagaacgcattcaccgagtcgtctggtgcctttaccggtgagattgcgccccag
cagttgaaggatgcgaatgtgcactgggtgattttggggcattccgagaggaggagtttg
tttggggatacggacaagttggtcgctgacaagaccaaggccgccatcaacgccggcctc
tccgtcattgcctgcatcggcgaatccctcgaagaacgcgaatccgacaagaccatgacc
gtcgttgagcgtcaacttgaggctatcgctgctgctattgacgttgatgcttggaaacgg
atcgtcattgcttacgaacccgtctgggctattggtaccggcaaagtcgccaccgtctcc
caagcgcaagaagtccacgctgccatccgctcctggctctctcgccgcgcttcccccgag
attgccgactcgacccgtatcatttacggcggttccgtcaatggcaagaactgtggcgaa
ttgagtgcggcaaaggatattgatgggttccttgtcggcggagccagtttgaaacccgag
tttatcgatatctgcaagtctggcaagaaggcgtaa

DBGET integrated database retrieval system