KEGG   Cryptococcus neoformans B-3501A: CNBF1030Help
Entry
CNBF1030          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     CNBF1030
Peptidases [BR:cnb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNBF1030
Transcription machinery [BR:cnb03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     CNBF1030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 599 aa AA seqDB search
MATPQSRIFDRTDTSICPHLSALLSIPSASSRNPGTSGAKGNTLGFPPGSKGAEIEKRFV
DVVKWGALPQGVKRRKTMSPGCHTCKTPLSRPWACLTCPYVGCMPLVGKGANEKDCMKRH
WKSSGRKCAFAVDPSTGTIFCEACGDTTYPDTFESLFLTTRIRVEESNDHSREPGLVGGK
GRGRGEWKSWNPNNIAALNEREVVRTSCRGLRPLLNLSQTCFLSAVLQALVHNPLLKAYF
LSDKHNRHVCTNGGKGLLVGKPFLGVENGPGAVGSDRERGCMCCEMDKAFEEFYNEDKSP
FGPITMLYAMWHASTELEGYGQQDAHSFFLAALDQIHAHAKGQLSSCNCIAHQTFAGSLQ
SSVICSKCSKTSNTVDPILDIQLDFPPPSVPSSASSSSDSSAFGPSTNGQADQLTLAGML
RKFCAPERVGDPGGNGYECSGCGGGVGVVAMRKLGVKKLAPVLSFQLKRFAHSSATTSVK
IESHVRFPSTLDMRPYVDSSSSSKSGNDRKEKELPDSLYIYDLFAVVTHEGKLDNGHYWA
DVRDGEEWWHCDDDKVTPTSLSAVLAQRAYMLFYVKRSIAYAQPMSRLLAGGSTGTNGA
NT seq 1800 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccctcaatcccgcatatttgacaggactgacacatctatatgccctcatttg
tccgctcttctcagcataccgagcgcctcttcaagaaaccctggcacatcaggagccaaa
gggaacactctagggtttccaccgggatccaaaggagctgaaattgagaaaaggttcgtg
gacgttgttaaatggggagctttaccgcaaggtgtcaagcgacggaagaccatgtctccg
gggtgtcatacttgcaaaactcctctttccaggccatgggcgtgccttacttgcccatac
gttggctgtatgccgcttgtgggcaaaggagctaatgagaaggattgtatgaagagacat
tggaagagcagcggaaggaaatgtgcttttgctgttgatccctctactggtaccatattt
tgtgaagcttgtggggatacaacatatcctgatacttttgaatcacttttccttactact
cgaatccgcgttgaagagtcaaacgatcattcacgcgaaccaggtttggttggtggcaag
ggaagggggagaggcgagtggaaatcgtggaacccgaacaatattgcggcgctcaatgag
agagaggtggtgaggacaagttgtcgtggtctacggccccttcttaatttatctcaaaca
tgtttcctctcggccgtccttcaagcacttgttcataatccgcttctcaaagcatacttc
ctctcagacaaacacaatcgacatgtgtgcacaaacggtggcaaaggccttttggtcggg
aagccgttcttaggtgtagagaacgggccaggtgcagtgggaagcgatagagagagggga
tgcatgtgctgcgagatggataaggcttttgaagagttctataatgaggacaagtcgcct
tttggacctatcacaatgctctacgccatgtggcacgcgagcacagagctcgagggttac
ggtcagcaagatgcccattctttctttcttgctgcgctggaccaaatccatgctcatgcc
aagggtcagctatccagctgtaactgcattgcccatcaaacctttgcgggctccctccaa
tcttccgttatctgctctaaatgctccaagacctccaacactgtcgatccaattcttgac
atccagctcgacttcccacctccgtctgttccttcatcagcatcctcatcctccgactca
tcggcttttggcccgtccaccaatgggcaagcggatcaactaacattagcgggcatgtta
cgcaagttttgtgcgccagagcgtgttggagatcctggagggaacggatacgagtgttct
ggatgtgggggcggcgtgggcgtagtggccatgagaaaattgggagtgaaaaagcttgct
ccagtgttgtcattccaactcaagcgttttgcccattcatccgccactacgtccgtcaag
atcgaatcccatgtccggttcccatccaccctcgatatgcgtccttacgtagactcttcc
tcatcttctaaaagtggcaatgacagaaaggagaaagaattaccagactcgctgtacata
tacgatctgttcgcagttgtcactcatgagggcaagctggacaatgggcattattgggcg
gatgtgagggacggcgaggagtggtggcattgtgatgatgataaggtcactcctacatct
ctctctgctgtattggcgcagagagcgtacatgcttttttacgtcaaacgatccatagcc
tatgcccagccaatgtcgaggttgttggctggcggcagcactggtaccaacggtgcttaa

DBGET integrated database retrieval system