KEGG   Cryptococcus neoformans B-3501A: CNBF1080Help
Entry
CNBF1080          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
cnb  Cryptococcus neoformans B-3501A
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 2360 aa AA seqDB search
MSSQSDVLDNIFQRLSARSEDVRAQAGQDLAEHVVAYTQEYPGHDASKGVWAQVFHKTFE
FTRSNNQLERLGAIISISQLLQLTKDDTLDRAQQKVLRLYEYLRPLTTCGDSTVMLPASL
VVEDMVRNSPTLHTDTFLGKEVGQALVMIDDSRQEVGRFSGALLLYAFARAAPGVFHQYI
PKVLEKIWVPLRDSRSVVRERASMLLSTCLDTLKTRGDRPSTDTYRKIFEEARLGLLKAS
STESILGSLLAFNSMLQNQQLSMAEYYRSICELTFKYRDSKEVSIRKAVIALIPSMATYD
SDDFEAHYLHRSMAYLLQALNRPADRDISYVALGHMAVHLGSKMKPFIDDIMRIIRDHLR
MRGKKNAPYEAPIFQCLAMLATSVGPMLTRQMHEILNLMFPWGLSEPLCTALQATASHIP
PLLRTIQDRLLEMLSQTLTGHSYRPLGAPAPRGGAQMDLNLLQSTTNAQSADTLKLALRL
LARFDFVGHTLSEFVRDAALPYLEHDSVEVRREAVLATTTLFMTDPICQQTSSNSVEIVN
DVLSKLLTVAITDPNAGIRRTVLDHLEDKFDRHLAQADDIRCLFIALNDEVFGNRERTIS
IIGRLAHHNPAYVMPHLRKSLINIVTELEYSTNARQKEESAKLLCLIIGAAAGLVKSYAP
TILSVLLRTASSPDSSIGVQAECLKCIGELARVAGEELVPSVRAILDLVIEMLNDQASPA
KRDTALKTLGQIASNTGEVIKPYTDYPQLMGVLFRFLRMEANSSVRQETIKTIGMLGALD
PFKHKTLLGDVDDPIDEGTTSRVNDIVLLNQHNSSVNDEFFQTVVIHSLVNVLHDSTYKD
HYQAVEAIMMIFRTQRLRCVNFLPQIVPAFLNVIRIAHSSRTELYLKQLAQFITIVKLHI
RNYLNDVFDLIHEFWNPNSTLQITIISLVEAIAKAVEGEFKAYLPKLLQQILRSFDGDLS
AKHLPELKLNTLLQILKAFYVFGESIEDYLHLVLPVIVRSFENPAAPDSLRIAALRTTGQ
LCRKVNFSDHASQIIHPLVRTLGNSSEELRQTAMETLCVLVLQFGPDYAIFIPMVNKALV
ENKISHPGYEALITQLLNRERLPPDLGPVERYASDSAVEASAPEPVALKVNQQALKLAWD
CSHLLNTSSRTEWISWIIGLGHEMMRESPSQAIRAARSLALSSVAFTKELFNVAFYSCWQ
ELFESYQEDLWHNLDRAIKKDDVPGDVVNMILGATQFLEHDEKEVAIESRVLGSVAANYQ
ALAVALHYKEQEFFLDPSKEVIEDLIDVNQKLQQSDAAWGTLEWAQTEMGMTTEVEWYEK
LGRWEEALQVWNERDADASTTFSEWEITEGKVTCLHAMGEWEQLSDFVQARWANRTAEEK
KLLSPLAAAASWSLKQWDLMDDYISAMKGDGADRAFFKAILAVHRNQIPAALKQISKARE
RLDPELTTLTGDSYGRAYDTVVRIQMLAELEEIIAYKDHADEPARQEMQRQTWKKRLAGC
QRDVEVWQRILQVRSLVLKPNEDMDTWIEFADLCRTSDRLNLAEKTLTSLVGFQYPSMED
TRGRAPPPIIFAYLRMAWAKNLQIDSREERYETLQHLRDFTDQLTDDVGIGARGPNGRLM
LPDQKLYGSYTKLLAQCHVELGQWQATLRESQGSADPSGILHDYSLATELDPEWYQAWHT
WALANFEVITQLEVSQQGLSPIHFTTYIIPAVEGFLKSISLSPGNSLQDTLRLLTLWFTY
GYSSGVTAAVSQGLPTVNIDVWLEVIPQIIARIQTPRQSIQQLIVQLLHDIGKAHPQALI
YPLTVASKSTVAARRTVAQNITHKMREHSPKIVDQAELVSTELIRAAILWHEMWYDGLEE
ASKHYFGDHDIPGMLGVLEPLHEIVENGPQTLRETSFIQSFGHDLRIAREHLKRYRITQD
GTEIQQAWDVYYSVFQRLGKQLKLLNVIELQYVSPKLMAVRDLDIAVPGTYQSGKPIIGI
KNVIPTFKVIASKQKPRQCSMRGMDGKEYAYCLKGHEDLRQDERVMQLFGLVNTLLNNDH
ESAKRHLSIQRFSVTPLSPSAGLLGWVTHSDTIHVLIKQYRDQRKILVDIEHKLMQQMSD
ESYDSLPLLHKVEIFQYALDNTTGQDLYRILWLKSRNSDIWLERRTTYTRSLGLNSMVGY
ILGLGDRHPSNLLLDQITGKMVHIDFGDCFEVAQQRDKYPEKVPFRLTRMLIHAMEVCGI
TGNFSRSCEVSMEVLRDNRESLMAVLEAFVYDPLIAWRLTATDKRPGGVGEVKDLDDPAV
YGKQRKNKANETEILNDVENTEVKNDKGLQVIERVRRKLTGRDFKPDVVLDVKSQVEKLV
VEATKTENLCVAFLGWCSFW
NT seq 7083 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacaatcagacgttctcgacaacatctttcagcgtctgtctgccaggtcggag
gatgtccgcgctcaggccggtcaagatcttgcagagcacgtcgtagcttatacccaggaa
tacccgggacatgatgcttcgaagggtgtatgggcacaggtctttcacaagacattcgag
tttactaggagcaacaatcagctagaaagattaggtgcaattatttccatctcgcaattg
ttacaactaacgaaggatgacacactggatcgtgctcaacaaaaggttctacgcctctat
gaatatcttcggcctctcacaacatgcggcgattcgaccgtcatgcttcccgcctcgctc
gtcgttgaagatatggtccgcaattcccccacccttcacaccgatactttccttggcaaa
gaagttggacaagcgctggtaatgattgacgactcacgtcaagaagtcggtcgtttcagt
ggtgctcttcttctctatgctttcgcccgtgctgcccccggagtattccatcaatacatc
cccaaggtcttggaaaagatttgggttccccttcgcgactcaagatctgtcgttcgagaa
cgtgcgagcatgctcttatctacctgccttgacactctcaaaacccgaggagaccgacca
tcaaccgacacctaccgcaagatctttgaagaggcccgtcttggtctcctcaaagccagc
tcaacagagtctatcttgggttctctccttgctttcaattccatgcttcaaaatcaacag
ctttcgatggcggaatattatcgctccatttgcgaactaaccttcaaataccgtgattcg
aaggaagtttccatcaggaaggctgtcatcgccctcataccttctatggcgacatatgat
agcgacgactttgaggcacattatttgcataggagtatggcgtatttgctacaagcgttg
aacaggccggcggacagggacatttcgtatgtggcattgggtcatatggccgtacatctt
ggatcgaaaatgaaaccttttattgacgacattatgcggatcattcgagatcatctacgc
atgcgaggcaaaaaaaatgctccatacgaagcccccatcttccagtgtcttgcgatgctc
gctacctctgtcggccctatgcttacccgccagatgcacgaaatcctcaacctgatgttc
ccctggggcctttcggaacccttatgtacagcccttcaagccactgcctcacatatccct
cctctattgaggactatccaagataggttgttggagatgctttcacagactttgaccgga
cacagctatagaccgttaggtgcgcctgccccaagaggtggagcgcagatggatcttaac
cttttgcaatctacaaccaatgcccagtcagcagacaccctaaaacttgctcttcgtctc
cttgcgcgctttgattttgtcggccatacccttagcgagtttgtccgtgacgctgctctt
ccgtatctggaacacgacagtgtcgaggtccgacgtgaagccgtgttggcgaccacgacc
ctgttcatgacggacccgatctgtcaacagacgagcagtaattcggtcgagattgtaaat
gatgtgttgagtaaattgttaaccgtagccattaccgatcctaatgctggaatccgccgg
acagtgctcgatcacctcgaagacaagtttgatcgccatctcgctcaggctgacgatatc
cgatgtctctttatcgctctcaacgatgaagtttttggtaatcgtgagaggactatctcg
atcattgggagattggcacaccataacccggcttatgtgatgcctcatttgagaaagagt
ttgatcaatattgtcactgagttggagtattctaccaatgcgcgacaaaaggaagagagt
gccaagctgctctgtcttataatcggcgctgccgcaggtctcgtcaagtcttatgcccct
accatcctatccgttcttctccgcactgcttccagccccgattcttctatcggtgtccaa
gccgaatgcctcaaatgtattggtgagcttgccagagttgcgggcgaagaactcgtcccc
tccgtccgagccattctcgacctcgtcattgaaatgctcaatgaccaggcttcccccgcc
aagagagatactgccctcaagactttagggcagattgcgagtaacacaggagaagttatc
aaaccctatacggattaccctcagttgatgggggtgctgtttaggtttttgagaatggag
gcgaattcgagtgtcaggcaagagacgatcaagacgattggtatgctcggtgccttggat
ccctttaagcacaagactttgttgggtgatgtggacgaccctatcgacgaagggacaacc
tcgcgagtcaatgacattgtgttgctcaaccaacacaactcttcagtcaatgacgagttc
ttccagactgttgtcatccattctttagtcaacgtcttgcatgactctacttacaaggat
cattatcaagccgtggaagcaattatgatgatttttaggactcaacgattgagatgtgtc
aacttcctccctcagatcgtccctgcattcctcaatgtcattcgcattgcacattcctct
cgtaccgagctttacctcaaacaacttgcgcaatttattacaatcgttaaactgcatatc
cgcaactacctcaatgatgtctttgatctaatccacgagttctggaaccccaactctact
cttcaaattaccatcatctccctcgttgaggccatcgcgaaggctgtggaaggtgaattc
aaggcatacttgcccaagcttttgcagcagattttgagatcgtttgatggagacttgtca
gccaagcacctcccggagctgaaactcaacactttgcttcagattctgaaagccttctac
gtctttggcgaatctatcgaagactacctccaccttgtcttgcccgtcattgttcgatct
tttgagaacccggccgcccccgattctctccgcattgctgctttgcgcactacaggacag
ctttgtcgtaaagtcaacttttcggaccatgcgagtcagatcatccacccgttggtaaga
actttgggtaatagctcagaggagttgaggcagactgcaatggaaacactttgcgttttg
gtgttgcagttcggcccagattatgctatcttcattcctatggtaaacaaagctttggtg
gaaaacaaaatatcacatcctggttacgaagcgctcataacccaattgctcaaccgcgag
cgccttcctccagatcttggccctgtcgaacgatacgccagtgactctgccgtcgaagcc
tctgccccagagcctgttgctcttaaggtcaaccagcaggctcttaaactggcctgggac
tgttcccacttgcttaacaccagcagcaggaccgagtggatctcttggattattggcttg
ggtcatgagatgatgagagaaagccctagtcaagccataagggccgcaaggagtttggcg
ttgagtagtgtggccttcaccaaggaacttttcaatgttgctttctactcatgctggcag
gagctgtttgagagttaccaggaggatttatggcataatcttgaccgagcaatcaagaaa
gatgatgtccccggcgatgttgtcaatatgattctcggggccactcagttcttggagcat
gatgaaaaggaagtagctatcgaaagtcgtgttttgggcagtgtcgctgccaattatcaa
gctctcgcggtcgctttacattacaaagaacaggaattcttcctggaccctagcaaggaa
gtcatcgaagacctcattgacgtcaaccagaaactccagcaaagcgatgccgcctggggt
acccttgaatgggctcagacagagatgggtatgactactgaggtcgagtggtacgaaaag
cttggaaggtgggaggaagcgttacaagtgtggaacgagcgagatgccgatgcttcgacc
actttctcagagtgggagatcactgaaggcaaggtcacttgtctgcacgctatgggcgaa
tgggaacaactctccgactttgtccaggctcgatgggccaacaggacggcagaggagaaa
aagttgctctcgccgttagcggcagcagctagttggtcgctgaaacaatgggatctgatg
gacgattacatctccgccatgaagggcgacggagcggatcgcgcgttcttcaaggctatc
ttagctgtgcacagaaaccaaatccctgctgctttgaagcaaatctccaaggcgcgagaa
aggctggatccagagttgactaccttaactggtgacagctacggccgagcgtacgatact
gtcgtgaggattcaaatgcttgctgagcttgaggaaatcattgcctacaaggatcacgcc
gacgagcctgcccgacaggagatgcaacgacagacttggaagaagcgtttggctggatgt
cagcgcgatgtcgaagtttggcagcgcattcttcaggtcagatcccttgtactcaagcct
aatgaggatatggacacttggattgagtttgcggacctctgtcgaacatctgacaggctg
aacttggccgagaaaacgctgacatctcttgttggcttccaatacccatcaatggaagac
actcgaggacgagcaccacctcccatcattttcgcttacctacgtatggcctgggcgaag
aaccttcaaatcgactctcgagaagaacgttacgaaactctccaacacttgcgagacttc
acggaccagcttaccgacgatgttggtatcggagcgaggggccccaacggcagactcatg
ttacctgaccagaagttgtatggatcttacaccaagctgctggcgcagtgccatgttgaa
ttgggtcagtggcaagcgactttgagggaaagccaaggatctgctgatccctcgggcatt
ctccacgactattctctcgccactgaacttgaccctgagtggtaccaagcttggcacact
tgggctttggccaatttcgaagttattacccagcttgaagtatcacagcaaggtctctca
cctattcactttacgacctatatcatccctgctgtcgaaggtttcctcaagtctatctcg
ctttctcctggcaactccttgcaagatactttaaggctgctgactctctggtttacatat
ggatactctagcggagtgacagcggccgttagccaaggtctgcccactgtcaacattgat
gtctggctcgaggtcatccctcagattattgcccgtatccaaacgccacgccagtctata
cagcagctcattgtacagctcttgcatgatattggcaaagcccatcctcaagcccttatc
taccctcttaccgtcgcctccaaatctacagtcgcagcccgacgcactgttgctcaaaat
atcacccataaaatgcgagagcactctcccaagatcgttgaccaggccgagcttgtcagt
actgagctcatccgagcggctatcttatggcatgagatgtggtatgatggtttggaagaa
gcgtcaaagcactactttggtgaccatgatatccctggcatgctgggagttcttgaacct
ttgcatgagattgtcgaaaacggaccccaaaccttgcgtgagacgtcctttattcaatcg
ttcgggcatgatttgcgtatcgcccgagagcatctcaagcgttaccgtataactcaggat
gggaccgaaattcaacaagcatgggatgtctactactccgtcttccagcgtctcggcaaa
cagctcaagctcctgaacgtcattgagctgcaatatgtctcgcccaagttgatggccgtt
cgagacttggatattgctgttccaggtacctaccagagtggcaagcctatcatcggtatt
aagaacgttatcccgaccttcaaggtcattgcttccaagcaaaagccaagacaatgcagc
atgcgcggtatggatggtaaagaatatgcgtactgcctcaagggtcacgaggacttgcga
caagacgagcgtgttatgcagctcttcggtttggtcaacactcttcttaataatgatcac
gagtctgccaaacgacatctcagtatccagcgattttctgttactcctctttcccctagt
gccggtttactcggttgggttacccacagtgataccatccacgtcctcatcaaacaatac
cgagaccaaaggaaaatcttggtggatattgagcacaaacttatgcagcagatgtctgat
gagagctacgattctctgccgctcttgcacaaggtcgagatcttccagtatgccttggat
aacacaactggtcaggatttgtaccgcatcttgtggctcaagtctcgtaactcagatatc
tggcttgagagaaggaccacctacactagaagtctgggtctcaactcgatggtcgggtat
atccttggcctgggtgacagacatccttcaaacctgttgctcgatcagattacgggtaag
atggtgcacattgactttggtgattgtttcgaggttgctcaacagagagacaagtaccct
gagaaagtaccgttccgacttacccgaatgctcattcatgccatggaggtctgcggtatc
actggcaacttttcgcgaagctgtgaagtgtccatggaagtccttcgtgacaacagagaa
tcacttatggccgtgcttgaagcatttgtgtacgatcctcttattgcttggcgtcttacg
gcgacggacaaacgacctggtggcgttggcgaagtcaaggacctggatgacccggcggtg
tacggaaagcagaggaaaaacaaggcgaacgagacagagattctcaatgatgtagaaaat
accgaggtgaagaatgacaagggtctgcaggtcattgaacgagtacgacgaaaattgacc
ggtcgagattttaagcccgacgttgtactcgatgtcaagtcccaagtggagaaattggtg
gttgaggcgacaaagacagagaacctgtgtgtggcgttcttgggatggtgttccttctgg
taa

DBGET integrated database retrieval system