KEGG   Cryptococcus neoformans B-3501A: CNBF1200Help
Entry
CNBF1200          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    CNBF1200
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    CNBF1200
   00603 Glycosphingolipid biosynthesis - globo series
    CNBF1200
   00604 Glycosphingolipid biosynthesis - ganglio series
    CNBF1200
   00511 Other glycan degradation
    CNBF1200
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     CNBF1200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 586 aa AA seqDB search
MLFSGLLEVLTSSLPFLAPSSPLSAKPDINVVPLPRHYIIGDGSTPVCLSTNFSIQAAPS
SLATFPTDLQDAITSTQHRLKNTQVTYLSPNEGSEFFTGGSGAIRSCVYYLDTLHIDFTA
YNGTDILSETVAPVEERAELEAYTLDLSLKGKATISSRGALGAFRGLSTFEGLFYSLEAG
VQGSDRVYAPLAPYHIEDKPSFGWRAVLLDTSRHYFSVPSILKILDTMSMVKLNVFHWHV
TDSNSWPLDLDSYPELAAKGASSQSERYSQKDMQMIIDYAGHRGIDTLLEIDTPGHTASI
APSHPSFVACFESTPFKHFAHQPPAGQLRFADEKVTEWTAQLLREIGSLSKGGYFSTGGD
EINMNCMLEDMPTASKLKAKGWTLDDALDHFTEKTHAPLRQAGKTPVVWQEMALNHGTMS
SLTNDTIVDIWVNSADARKVLDQGYRIVHASADYFYLDCGQGGWIGEEGGNNSWCDPMKS
WARMYSFDPFKDVKDEERHLVLGGQTSLWTEQTDETNLEPTLWPRAAALAEVFWSGPGQD
SRPRSSNKALPRMHDIRYRMVGRGVRAAPLQPRWCALRPGACILAA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgctcttcagtggcctgctcgaagttctcacctcgtctctaccgttccttgctccttcg
tctcctctttcggccaaacccgatatcaatgtcgtccctttgcctaggcattacatcatc
ggggatgggtcgacgcctgtttgtctttctaccaatttcagcatacaagcagccccctca
tctttagccactttcccgactgaccttcaagatgccatcacatcaactcaacaccgcttg
aagaacacccaggtaacgtatctttcgcccaacgaaggatcagagtttttcaccggcggc
tctggtgctattagatcttgcgtatactatctcgacaccttgcacattgatttcactgcc
tataatggtaccgatatcctctcggaaaccgttgcacccgtcgaagaacgcgccgagctc
gaggcatatacgcttgatctctctctcaaggggaaagcgacgatcagctctcgaggggct
ttgggtgcgttcagaggtctcagcaccttcgaaggcctcttctacagccttgaggctgga
gttcagggatcggacagagtgtatgctccactcgctccttatcatattgaagacaagcca
agttttggctggcgtgcagtattattggatacctcgaggcattacttttccgttccatcc
atcctgaagatactggatacgatgtccatggttaagctcaacgtcttccactggcacgtc
acggactccaattcatggcctttagatcttgacagctatccagaactcgcagccaaagga
gcatcctctcagtctgagaggtatagccagaaagatatgcaaatgatcattgactatgca
ggccacagaggcattgacacccttctcgagattgacacaccgggccacactgcctctatt
gctccttcgcatccctccttcgtggcatgcttcgagtcaacgccattcaaacactttgct
caccagcctccagcaggacaattgcgatttgccgacgagaaggtgacagagtggacggct
cagctcctgcgggagatcggcagtctgtccaaaggaggatatttcagtacgggaggggat
gagatcaatatgaactgcatgttggaagatatgcctacggcgtctaagctgaaagccaaa
ggctggacgttggatgacgccttggatcattttactgaaaagacacatgcccccttgagg
caggcaggaaaaactccagtggtctggcaagagatggcgctcaatcacgggacgatgtct
tctcttactaatgacaccattgttgatatctgggtcaactctgcggacgctcgcaaggtt
ctggaccaaggataccgtatagtccacgcttcggcagactacttttacctggactgtgga
caaggcggatggataggggaagagggaggtaataacagctggtgtgatcccatgaagtct
tgggcaagaatgtattctttcgaccctttcaaagatgtcaaagacgaagagaggcacttg
gttttgggtggtcaaacatcgctctggacagagcagacggacgagacgaacttggagcct
actctctggcctagagcagcagctttagcggaagttttctggtcagggccaggacaagac
agccgacctcgcagttcaaacaaggcgctacctagaatgcacgatatccgttatagaatg
gtgggaagaggtgtgagagctgcacctttgcagcctcgttggtgcgcccttcgtcccggt
gcgtgtattttagctgcttga

DBGET integrated database retrieval system