KEGG   Cryptococcus neoformans B-3501A: CNBF2260Help
Entry
CNBF2260          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CNBF2260
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     CNBF2260
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 238 aa AA seqDB search
MPTSLKHLKISPKEAHTATVIFLHGLGDSGHGWLPVAKMLWSSFPNVKWILPHAPTIPVS
LNHGMAMPSWFDIRHLDKLDNSENDDEQGMLETLKSVDELIQAEVDSGIPENRIVLGGFS
QGGAISVLNMLTTKRKLAGVVALSTWVPLNHKIVQMMSEHAKDIPVFWGHGTNDPVVDYR
FGQRSVDFLVQKCGYKLLSQGTTFARPGIRFESYPGMPHSSCPQEIEDLKSWLMEALK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcccacatctttgaaacacctaaagatttcgcccaaggaggcccatactgctactgtc
atctttcttcacgggttgggcgatagtggccatgggtggcttcctgttgctaagatgctt
tggagctcgttccctaatgtgaaatggatacttccacatgcccctacaatccccgtctcc
ttaaaccacggcatggctatgccatcttggttcgacattcgtcaccttgataaattggat
aactcggagaacgacgatgagcaggggatgctcgaaacgctaaagtcagttgacgagctt
atccaagccgaggtggatagtgggatccctgaaaataggatcgttctcggtggtttttcc
cagggcggcgcgatcagtgttctaaacatgctgacaacaaagaggaagctggctggagtg
gtggcgttgagcacttgggtccctctcaaccacaagattgtacaaatgatgtctgagcat
gccaaggatattccagtgttctggggccacggaacgaatgacccagtggtcgattaccgc
tttggacaacgatcagttgattttcttgtacaaaaatgtggctacaagctgctttctcag
ggcacaacctttgctcgtcctggtatccgttttgaatcctacccaggaatgccccattct
tcctgtcctcaggagattgaagatctcaagtcgtggttaatggaggcgctcaagtaa

DBGET integrated database retrieval system