KEGG   Cryptococcus neoformans B-3501A: CNBF2260Help
Entry
CNBF2260          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cnb00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6
AA seq 238 aa AA seqDB search
MPTSLKHLKISPKEAHTATVIFLHGLGDSGHGWLPVAKMLWSSFPNVKWILPHAPTIPVS
LNHGMAMPSWFDIRHLDKLDNSENDDEQGMLETLKSVDELIQAEVDSGIPENRIVLGGFS
QGGAISVLNMLTTKRKLAGVVALSTWVPLNHKIVQMMSEHAKDIPVFWGHGTNDPVVDYR
FGQRSVDFLVQKCGYKLLSQGTTFARPGIRFESYPGMPHSSCPQEIEDLKSWLMEALK
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgcccacatctttgaaacacctaaagatttcgcccaaggaggcccatactgctactgtc
atctttcttcacgggttgggcgatagtggccatgggtggcttcctgttgctaagatgctt
tggagctcgttccctaatgtgaaatggatacttccacatgcccctacaatccccgtctcc
ttaaaccacggcatggctatgccatcttggttcgacattcgtcaccttgataaattggat
aactcggagaacgacgatgagcaggggatgctcgaaacgctaaagtcagttgacgagctt
atccaagccgaggtggatagtgggatccctgaaaataggatcgttctcggtggtttttcc
cagggcggcgcgatcagtgttctaaacatgctgacaacaaagaggaagctggctggagtg
gtggcgttgagcacttgggtccctctcaaccacaagattgtacaaatgatgtctgagcat
gccaaggatattccagtgttctggggccacggaacgaatgacccagtggtcgattaccgc
tttggacaacgatcagttgattttcttgtacaaaaatgtggctacaagctgctttctcag
ggcacaacctttgctcgtcctggtatccgttttgaatcctacccaggaatgccccattct
tcctgtcctcaggagattgaagatctcaagtcgtggttaatggaggcgctcaagtaa

DBGET integrated database retrieval system