KEGG   Cryptococcus neoformans B-3501A: CNBG0190Help
Entry
CNBG0190          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.4.19.12]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CNBG0190
Peptidases [BR:cnb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNBG0190
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 484 aa AA seqDB search
MPKSQNMELSVKHSGKTYTVPVTQETTTQAFKDAISQLTRVPTERMKVMVKGKLVKDDTD
YVALANQKQSVMVIGAAEALPPPPTQQIVFLEDVGDEGIKSDEPTGLINLGNTCYLNSTL
QAIRAMPEVHQALKEFTPSSSSSSSLPEFRVTNSLKNLFVTIDNTPNAVPPLEVISNLRI
LAPQFAERDQRGHYAQQDADEAWTQLVQALRAALPKNGDEGSVVDRLMSIELTKTLKNAE
TEEEPETTSTETVLKLECNISGTTNFLMSGIQDNLNQQVEKTSATLGRNATYSMQSRVSR
LPEYLVVHMVRFYWRRDIQKKAKIMRKVKFPLELDLSDIVTEPLRKKIQPLNTATKQILK
ERDARANILKRKPGQGLDEEEKKRGEEKAMVEELVKEGGLTSGEGSGMYELAAVVTHKGA
SADSGHYIGWSRVDNGACVPAEQQRWAKFDDNNVTFTDANKILSMDGGGEDSVAYILLYR
AAKI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatcccaaaatatggaactcagcgtaaaacattctggcaagacgtacaccgtt
cctgtcacacaagagaccacgactcaggctttcaaggatgctatctctcaacttaccagg
gtccctactgagaggatgaaggttatggtgaagggcaagctggtgaaggatgatacagat
tatgtcgctttggcaaatcaaaagcaatctgttatggtaattggagcagctgaagcgtta
ccaccaccaccaacccagcaaatcgtctttttggaagatgtaggggatgaaggcattaaa
tccgacgaacccacgggtctcatcaacctcggcaacacctgttacctcaactccacgctc
caagccatccgcgctatgcccgaagtccaccaagcgctcaaagaattcactccttcctcc
tcctcctcttcttccctccccgaattccgcgtcacaaattcgttgaaaaatctgtttgtt
acgattgacaatacacctaatgccgttcctccattggaagttatcagtaatttgagaatc
ttggcgcctcaatttgcagagagggatcagagggggcattacgcacagcaggatgcggat
gaggcttggacgcagcttgtgcaagcgttaagggcggcgttgccgaagaacggggatgaa
gggtctgttgtggaccgtttgatgtctatcgaattaaccaagactctcaaaaatgcagag
acagaggaagaaccagagacaactagtacggagactgtcttgaaactggagtgtaacatc
tctgggaccacaaatttcttgatgtctggtattcaagacaaccttaaccagcaggttgag
aagacgagcgcgacactgggacgaaacgcaacttactctatgcaatctcgcgtttctcga
ttgccggagtaccttgtagtgcacatggttcgattttattggcgtcgtgacatccagaaa
aaggcaaagatcatgcgtaaagtcaagtttccactcgaactcgacttatctgacatcgtg
accgagcccctccgcaaaaagattcaaccccttaacacggcgacgaaacaaatcctcaag
gaacgtgatgcccgtgcgaatatcttgaaacgaaagcccggacagggattggatgaagaa
gaaaagaaaagaggtgaagaaaaggctatggtggaagagcttgtgaaagaagggggacta
accagtggagaggggagtggaatgtacgagctcgctgctgtggtaacacacaaaggcgcc
tctgccgattccggccattatattggctggtctcgcgttgacaatggcgcatgtgtccct
gccgaacaacagagatgggccaagttcgacgataacaatgtaactttcacagatgcgaac
aagatcttgtcaatggatggaggtggtgaggattcagtagcttatattttgctttatcgg
gcggcgaaaatctag

DBGET integrated database retrieval system