KEGG   Cryptococcus neoformans B-3501A: CNBG0190Help
Entry
CNBG0190          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
cnb  Cryptococcus neoformans B-3501A
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 484 aa AA seqDB search
MPKSQNMELSVKHSGKTYTVPVTQETTTQAFKDAISQLTRVPTERMKVMVKGKLVKDDTD
YVALANQKQSVMVIGAAEALPPPPTQQIVFLEDVGDEGIKSDEPTGLINLGNTCYLNSTL
QAIRAMPEVHQALKEFTPSSSSSSSLPEFRVTNSLKNLFVTIDNTPNAVPPLEVISNLRI
LAPQFAERDQRGHYAQQDADEAWTQLVQALRAALPKNGDEGSVVDRLMSIELTKTLKNAE
TEEEPETTSTETVLKLECNISGTTNFLMSGIQDNLNQQVEKTSATLGRNATYSMQSRVSR
LPEYLVVHMVRFYWRRDIQKKAKIMRKVKFPLELDLSDIVTEPLRKKIQPLNTATKQILK
ERDARANILKRKPGQGLDEEEKKRGEEKAMVEELVKEGGLTSGEGSGMYELAAVVTHKGA
SADSGHYIGWSRVDNGACVPAEQQRWAKFDDNNVTFTDANKILSMDGGGEDSVAYILLYR
AAKI
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgcccaaatcccaaaatatggaactcagcgtaaaacattctggcaagacgtacaccgtt
cctgtcacacaagagaccacgactcaggctttcaaggatgctatctctcaacttaccagg
gtccctactgagaggatgaaggttatggtgaagggcaagctggtgaaggatgatacagat
tatgtcgctttggcaaatcaaaagcaatctgttatggtaattggagcagctgaagcgtta
ccaccaccaccaacccagcaaatcgtctttttggaagatgtaggggatgaaggcattaaa
tccgacgaacccacgggtctcatcaacctcggcaacacctgttacctcaactccacgctc
caagccatccgcgctatgcccgaagtccaccaagcgctcaaagaattcactccttcctcc
tcctcctcttcttccctccccgaattccgcgtcacaaattcgttgaaaaatctgtttgtt
acgattgacaatacacctaatgccgttcctccattggaagttatcagtaatttgagaatc
ttggcgcctcaatttgcagagagggatcagagggggcattacgcacagcaggatgcggat
gaggcttggacgcagcttgtgcaagcgttaagggcggcgttgccgaagaacggggatgaa
gggtctgttgtggaccgtttgatgtctatcgaattaaccaagactctcaaaaatgcagag
acagaggaagaaccagagacaactagtacggagactgtcttgaaactggagtgtaacatc
tctgggaccacaaatttcttgatgtctggtattcaagacaaccttaaccagcaggttgag
aagacgagcgcgacactgggacgaaacgcaacttactctatgcaatctcgcgtttctcga
ttgccggagtaccttgtagtgcacatggttcgattttattggcgtcgtgacatccagaaa
aaggcaaagatcatgcgtaaagtcaagtttccactcgaactcgacttatctgacatcgtg
accgagcccctccgcaaaaagattcaaccccttaacacggcgacgaaacaaatcctcaag
gaacgtgatgcccgtgcgaatatcttgaaacgaaagcccggacagggattggatgaagaa
gaaaagaaaagaggtgaagaaaaggctatggtggaagagcttgtgaaagaagggggacta
accagtggagaggggagtggaatgtacgagctcgctgctgtggtaacacacaaaggcgcc
tctgccgattccggccattatattggctggtctcgcgttgacaatggcgcatgtgtccct
gccgaacaacagagatgggccaagttcgacgataacaatgtaactttcacagatgcgaac
aagatcttgtcaatggatggaggtggtgaggattcagtagcttatattttgctttatcgg
gcggcgaaaatctag

DBGET integrated database retrieval system