KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBG3290Help
Entry
CNBG3290          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K00814  alanine transaminase [EC:2.6.1.2]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00220  Arginine biosynthesis
cnb00250  Alanine, aspartate and glutamate metabolism
cnb01100  Metabolic pathways
cnb01200  Carbon metabolism
cnb01210  2-Oxocarboxylic acid metabolism
cnb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CNBG3290
   00220 Arginine biosynthesis
    CNBG3290
Enzymes [BR:cnb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     CNBG3290
Amino acid related enzymes [BR:cnb01007]
 Aminotransferase (transaminase)
  Class I
   CNBG3290
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_1_2
Motif
Other DBs
NCBI-GeneID: 4937365
NCBI-ProteinID: XP_774348
UniProt: F5H9E5
Position
7
AA seq 513 aa AA seqDB search
MPRLSNVYCPKSLLQRQTIQIRSFSQTMSPFKPALTLDTINPAVQAVHYAVRGELAIKAD
KYVQVLADITHKPLPFEKIVTANIGNPQQQGLDQVPLTYWRQIISLLEYPDLMQKHEQLA
KQIYPGDVIERARALHNEIGSTGAYTHSKGVLGIRKRVAKFIEERDGYPADPQNIFLTAG
ASAGVASILGVALRRGDGCMIPIPQYPLYTATLAYLESEPLPYYLSEADDWSMNHDSLLK
SVEEGKKKGIPIKALVIINPGNPTGACLSQEAMEAVVHLCYEEGIVLLADEVYQMNVFDP
EQRPFISFKKVLMDMPKEIRESVELVSFHSISKGVSGECGRRGGYFECVNIDKDVMDQVY
KMASVTLCPPVSGQIGVDLMVSPPKPGDESYPLWKEETDLIQNNLKSRSYLMAEHFNKME
GVSCNNAEGAMYLFPRINIPPKAVEAAKKLGKEPDVMYALDLLDATGICAVAGSGFGQEP
GTFHLRVTALCPDTAEFIGRFQKFNKEFMEKYA
NT seq 1542 nt NT seq  +upstreamnt  +downstreamnt
atgcccagacttagcaacgtctattgtcccaagtcactcttacaacgtcagaccatccaa
atcaggtcattcagtcagactatgtcacctttcaaacccgcgcttactcttgataccatc
aaccccgcggttcaggctgttcactatgctgtccgaggcgagctcgcgatcaaggcggac
aaatatgtccaagtccttgccgatataactcacaagcctttgccgtttgaaaagatcgtc
actgccaacatcggtaatccccaacaacaaggtcttgatcaagttcctctcacttattgg
cgacaaattatttccttattggagtatcccgatctgatgcagaaacatgagcagttggcc
aagcagatttaccctggagatgtgattgagcgagccagggcgttacataacgaaattgga
agtacgggtgcgtacactcattccaagggtgtgttgggtatcagaaagagagtcgccaag
tttatcgaagaacgcgacggttacccggcggaccctcaaaatattttcctcaccgccggt
gcttctgccggtgttgcttcaatcctcggtgtcgcactccgtagaggcgatggctgcatg
atccccatcccccaatatcccctctataccgccaccctcgcttacctcgagtctgagcct
ctgccatactacctttctgaagcggacgactggtcgatgaatcacgattctttgctcaag
agcgtggaggaaggcaagaagaagggtatccccatcaaggcgcttgtaatcattaacccc
ggaaaccctaccggcgcatgtttgagccaagaggcgatggaggcggttgtgcatctctgt
tatgaggaaggtatcgtcctcctcgcagacgaggtttaccagatgaacgtctttgacccc
gaacagcgaccgttcatttctttcaaaaaggttttgatggatatgcccaaggagatcagg
gaaagtgtggaactggtatctttccattcgatctcaaaaggtgttagtggagaatgtgga
aggagaggtggatactttgaatgtgtcaacattgataaggatgtgatggaccaggtttac
aagatggcgagtgtcactttatgtcctcccgtctcaggccagatcggtgtcgacctcatg
gtctcccctccgaaacccggagacgaatcttaccccttatggaaagaagaaaccgatctg
atccaaaacaatctcaagtcccgatcatatctcatggctgagcatttcaacaaaatggaa
ggtgtttcttgcaacaatgcggaaggagccatgtacttgttcccgaggattaatatccct
cccaaagctgtagaggcggcgaagaagttgggtaaggaaccggatgtgatgtatgctttg
gatcttcttgatgcgaccggtatctgtgcggtggcaggcagcggttttggccaagaaccg
gggacgttccatttgcgagtgactgccctgtgtcccgatactgctgaatttatcggtcga
ttccaaaagttcaacaaggaatttatggaaaagtatgcctaa

DBGET integrated database retrieval system