KEGG   Cryptococcus neoformans B-3501A: CNBG4230Help
Entry
CNBG4230          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CNBG4230
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CNBG4230
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     CNBG4230
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 398 aa AA seqDB search
MLSRVSPSLRQVLAAPLRASRMGTSPMQKAFTHSSAPRNHHITAQPSSEKGLTSPTYNYK
FLNEPATASLVGCPFSGGQGRAGVDLAPNKLVSAGLVEQISALGWNVHYESHQNFLDIPY
NPLPSSSPVTSTEGPSTHTTTAQGEKMVQGLPDPDIGSMKKPRLVSAVNEMVAKEVGDIA
EKGWLPVTLGGDHSLAMGTIAGTKRKYPNAGVIWVDAHADINTPLTTESGNLHGCPVSFL
LGLDGCDVEPFNKWLKPCLKPEDIVYIGLRDIDDAEKKILKENNIKTFTMHHVDRHGIGK
VMELALQHINPNGDRPLHLSFDVDALDPTVAPSTGTPVRGGLTFREGHYITEVVAETGCL
VALDIMEVNPSLLDPRSVEMTVAAGCSLTRASLGETLL
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgctctctcgcgtctctccatctcttcgtcaagtccttgctgccccattgagggcatca
aggatgggcacttcccctatgcaaaaagcgttcacccactcatcagcacctagaaaccat
catattaccgctcagcctagtagtgagaagggtcttacctcccctacttacaattacaag
tttttgaacgagcctgctactgcttctcttgtcggatgcccttttagcggtggacaaggt
cgagctggtgtcgatctcgccccaaacaagctcgtctctgccggtcttgtagagcaaatc
tcggcccttggctggaacgtccattacgaatctcaccaaaacttcctcgacatcccttac
aacccccttccttcttcttcccccgtcacttcaaccgaaggcccctctacccacactacg
accgctcagggcgaaaagatggtccaggggttgccggatcctgatattggaagcatgaaa
aaacctaggttagtcagtgcggtgaacgaaatggtagccaaggaggttggggatatcgcg
gagaaggggtggttgcctgtgactttgggaggcgaccacagtttggcgatgggtactatt
gctggtactaagcgcaagtaccctaacgctggtgtgatctgggttgatgctcacgccgat
atcaacacccccttgaccaccgagtctggcaatctccacggctgccctgtttctttcctc
ttgggtttggatggctgtgacgtcgagcctttcaacaagtggcttaaaccttgcctcaag
cctgaagatatcgtctacatcggtctccgggacattgacgacgccgagaagaagattctg
aaggaaaataacatcaagactttcactatgcaccacgtcgacaggcacggtattggcaaa
gtcatggaacttgcgcttcagcatatcaaccccaatggtgaccgaccccttcacctcagt
ttcgacgttgacgctcttgaccccacagttgctcctagcacaggtacccccgttcgaggt
ggtctgactttccgagaaggccattacattaccgaggttgttgctgagaccggctgcctc
gtcgctttggacatcatggaggtcaacccttccctgcttgaccccaggtccgtcgagatg
actgtcgctgctggctgctccctcacgcgggcatctttgggtgagactttgttgtaa

DBGET integrated database retrieval system