KEGG   Cryptococcus neoformans B-3501A: CNBG4610Help
Entry
CNBG4610          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00877  
hydroxymethylpyrimidine/phosphomethylpyrimidine kinase [EC:2.7.1.49 2.7.4.7]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Thiamine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    CNBG4610
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.49  hydroxymethylpyrimidine kinase
     CNBG4610
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.7  phosphomethylpyrimidine kinase
     CNBG4610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 542 aa AA seqDB search
MASRNELSLEPRTRPHVMTIAGSDSGGGAGIQADLKTIEAFGCYGSSVLTGLTAQNTLGV
QAVHVVPTDFVIQQLQSVISDELPKAIKLGMLTCASTIRALAREVSKLNTTIVLDPVMIS
TSGHTLLPDDAMEALYELYPHVDYLTPNIPEAKNLSGWSHEIKNLDDMIELAKKTNEMTK
SPSVLLKGGHAIVSREEVLKYAGKYELIWEEGDDEDDAVEVYNEYKESLDINIKTQKDLV
VDLLIKEGEIIAMFVGKKVDSQSTHGTGCTLSAAIACSIAVSSEVADAKSLISVFKRAIG
YTQSAIATAFPFGHGHGPLNHGHLSMRRALPFPSKHNPHPFLTHLIQSDLYLWKSYVRHP
FVVQLGKGTLPRKCFEHYIKQDYHYLKHYARAHALGAYKADSFEDIKAFTEISLHIARES
TMHVAYCQEFGVSLADLEETPESANCSAYARYVIDIGTQGDILDLYMAVASCLVGYGEVG
LWLKKQVERGEAKVEDNLYGRWMTDYGGRDFLNAVNRGIGNLERRECVRLESGFWDMGLN
LL
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atggcaagcagaaacgagctgtcacttgagccccgtaccagacctcatgttatgaccatc
gctggcagcgactctggcggcggtgctggtattcaggctgacctcaaaactatcgaggcc
tttgggtgctacggctcgtccgtattgactggccttactgcgcagaacactcttggtgtc
caggcagtccatgtcgtaccgaccgactttgtcatccagcaactccaatctgtcatttca
gatgaactccccaaagccatcaagctcggaatgctcacttgcgcttctaccattcgcgcc
ctcgcccgggaagtttccaagctcaacacaacaatcgtcctcgaccctgtcatgatctct
accagcggtcacaccctattaccggacgatgctatggaggcgctttacgagctttatccc
cacgttgactatcttacacccaatattcccgaagctaaaaacctttctggatggagtcat
gagattaagaacttggacgatatgattgagctcgcaaagaagaccaacgagatgacgaaa
tccccttctgtgcttttaaaaggtggacatgcaattgtttctcgtgaagaggtgctcaag
tatgccggaaagtacgaacttatctgggaggagggcgatgatgaggatgacgctgtggaa
gtgtacaatgaatacaaggaatcactcgatataaatatcaaaactcagaaagaccttgtt
gttgacttgttaataaaggaaggcgagatcatagcgatgtttgtggggaaaaaagtggac
agccagagtactcatggtaccggatgtaccctcagtgcggctatcgcttgttctattgcc
gtctcaagcgaggtagcggacgcgaaatccttgatatccgtcttcaaaagggcgatcggt
tatacccaatctgccattgctaccgctttcccatttggtcatggccatggccctcttaac
cacggtcatctcagtatgcgccgagctctcccttttccatcaaaacacaaccctcacccc
tttctcacacatctcattcagtctgatctttacttatggaaatcctacgtccgacatcca
tttgtcgtccaactcggtaagggtacccttcccagaaagtgctttgagcattacatcaag
caggattatcactacctgaaacattacgcccgtgctcacgctcttggtgcttacaaagcc
gacagctttgaagatatcaaagcgttcaccgaaatatccctgcacatcgcccgagaatcc
accatgcacgtcgcctactgccaagaattcggcgtctcactcgccgacctcgaagaaact
cccgaatcagcaaactgctctgcttacgcacggtacgtcatcgatatcggaactcaggga
gatatccttgacctctacatggctgtggcgtcgtgtttggttggctatggtgaagtagga
ttgtggttgaaaaagcaggtggaaaggggggaagcaaaggtggaggataatctgtatgga
aggtggatgacggattatggggggagagactttttgaatgcagtgaatagaggtattgga
aacctggaacgacgtgagtgtgtcagactcgagtctgggttctgggatatgggcttgaat
ctactatag

DBGET integrated database retrieval system