KEGG   Cryptococcus neoformans B-3501A: CNBG4680Help
Entry
CNBG4680          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CNBG4680
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     CNBG4680
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 558 aa AA seqDB search
MAKRLLQGLNLGAGLAVKWYAFVFLRLLPAGPRYLPTILSCTLMYLASYFSLRSLAQKPI
RTSIITPILVLGGLYHPMYRLLSTVGALVTLIAPLMSYDFVYRTHLLHPSLHISFARVGW
VTETSASLLFRSTFPDRIDVSYWPSHNDSAVSHVGLSQSSVKTDFTSPLYIKNLQPGITY
FYNSTAGHKGSFTTRRSQHDQKQFSILSTSCQKPNWPYNPLSHSLAINGLEHVDNVVRKM
KRKPEAMLFLGDFIYSDLPYPIADYTTSYYRRLYRQIYSSPSWTPFLRSIPWLHMFDDHE
IINDYAPSTSALSNMFIEAIDPFINYQQVVNPPPVSSTQPTYFRFGIGDVSFFVLDCRSW
RSAQPARPGSNSTAGFGNRTMLGESQFTAVKEWAEEGTRDGKLLVLVSGVPITRNWSEGD
DEMDSWAGYLDEREEILEMLWSSGGAVVISGDRHEHATTLFPPPPTSPHLSSSSVIEFST
SPLSFFHQPWTREYIPHPDTDIPIHLQWQGDSRFGVFEFDTTGERPRVKFELMVDGEKEW
EYEWVKGVDVVIPDVWQA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagagattattacaggggctgaatttgggtgctggcttggcggtgaaatggtat
gccttcgtgtttctacgcctgcttcccgctggacctcgatatctcccaactattttgagc
tgtactttaatgtacctcgcatcttacttctcacttcgctcccttgctcaaaaaccaatt
cggacgtcgattatcacgcccatcctagttcttggtggactttaccatcccatgtatcgt
cttctctcgacggttggtgctttggtcaccttgatagctccgcttatgtcgtacgacttt
gtctaccgcacccatttactacatccgtcactacacatatccttcgctcgggttggctgg
gtaacagaaacgtcggccagcctcttatttcgatctaccttcccagatcgaatcgacgta
tcctattggccttctcacaatgacagcgccgtctcacatgtcggactttctcaatccagt
gtcaaaaccgacttcacttctcctctgtacatcaaaaatctgcaaccgggcatcacatac
ttttataactcgactgccggccacaaaggttcgttcactactagacgatcacaacatgat
cagaagcaattcagcattctgagtacaagctgccaaaagcccaactggccctataatcct
ctgtctcattcgttggcaattaatggtttagaacatgtcgataacgtggtccgaaaaatg
aagagaaaaccggaagcgatgctgttcttaggcgacttcatctattcagacctcccatat
cccatcgccgactataccacttcgtactatcgccgactttaccgccagatctactccagc
ccatcttggaccccatttctgcgttcaatcccctggctacacatgtttgacgaccacgag
atcatcaacgactatgccccttccacttctgccctttccaacatgttcatagaagccatc
gatccgttcataaactatcagcaagttgtcaaccctcccccggtcagctccacacaaccg
acgtacttccgctttggaataggcgatgtatcattcttcgtcttggactgccgatcatgg
cgttcagctcaaccagctagacctggatccaattctacagctggctttggcaacaggacg
atgcttggagaatcacaatttacggcagtcaaagaatgggcagaagaagggacgagagat
ggaaaattactggtgcttgtatcaggagtaccgattactcgcaattggtcggaaggggat
gatgagatggacagttgggctggttatcttgacgaacgtgaggagattcttgaaatgttg
tggtcgtccggaggagccgtcgtcatctccggcgatcgacatgagcacgcaaccacatta
ttccctcctccgcctacgtcgcctcacctgagctcatcatccgtcatcgagttctccacc
tctcctttgtcattttttcaccaaccttggacccgagaatacatcccacatccggacact
gacattcccatccatctgcaatggcaaggtgatagtcgctttggtgtgttcgagtttgat
accactggagaaagaccgagagtcaagtttgaattgatggtagatggtgagaaagaatgg
gagtatgagtgggtaaaaggggtagacgtggtaattccggacgtatggcaggcgtaa

DBGET integrated database retrieval system