KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBH0240Help
Entry
CNBH0240          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00062  Fatty acid elongation
cnb00071  Fatty acid degradation
cnb00280  Valine, leucine and isoleucine degradation
cnb00310  Lysine degradation
cnb00380  Tryptophan metabolism
cnb00410  beta-Alanine metabolism
cnb00640  Propanoate metabolism
cnb00650  Butanoate metabolism
cnb01100  Metabolic pathways
cnb01110  Biosynthesis of secondary metabolites
cnb01130  Biosynthesis of antibiotics
cnb01200  Carbon metabolism
cnb01212  Fatty acid metabolism
Module
cnb_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
cnb_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    CNBH0240
   00650 Butanoate metabolism
    CNBH0240
  Lipid metabolism
   00062 Fatty acid elongation
    CNBH0240
   00071 Fatty acid degradation
    CNBH0240
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CNBH0240
   00310 Lysine degradation
    CNBH0240
   00380 Tryptophan metabolism
    CNBH0240
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CNBH0240
Enzymes [BR:cnb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     CNBH0240
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-GeneID: 4937536
NCBI-ProteinID: XP_773977
UniProt: Q55NR5
Position
8
AA seq 283 aa AA seqDB search
MLARTLLKPSQSTYRLTIRAMSTSAEQLVIPSRSPSNNVAILTLNRPKALNALSTPLFNA
LNAELEKAETDESVRAIVITGGDKVFAAGADIKEMKDKEFAEAYTSNFLGSWNQIASIRK
PIVGAVAGYALGGGCELAMLCDILVASPTAVFGQPEITLGIIPGMGGSQRLTSLIGKARA
MDMVLTGRKIDAETAERWGLVSRVTKEGESVTEEAVKVAENVSKFGKVAVQAGKEAVNGS
LDLPLEQGLRLERRLFQQLFATKDQKEGMAAFAEKRKPTWSDK
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgttagctcgcactctcctcaagccttcccaatctacataccgactcactatccgcgcc
atgtccacctctgcagaacagctcgtcatcccctctcgttctccttcgaacaacgtagcc
atcttgacccttaacaggcccaaggccctcaacgcgttgagcacgcccttgttcaatgct
ctcaacgccgagcttgagaaggccgagacagatgagagtgtgagggctatcgtcatcacc
ggtggtgacaaggtgtttgctgccggtgccgacatcaaggagatgaaggacaaggaattt
gctgaagcatacactagcaacttccttggatcctggaaccaaatcgcctctatccgcaag
cccattgtcggtgctgtcgccggctacgccctcggaggcggatgtgagctcgccatgctc
tgcgacatcctcgtcgcttctccgaccgccgtctttggccaacccgagatcacacttggg
attattccaggtatgggcggctcccaacgccttacttccctgattggaaaggcgagggca
atggacatggtcctcactgggaggaagattgatgcggagacggctgagagatgggggttg
gttagcagggttacgaaagaaggagagagtgtgactgaggaagcggtgaaggtggcagag
aacgtgagcaagtttggaaaggtggctgtacaggctggtaaggaggccgttaatggatct
ctcgaccttcccctcgagcaaggtctaaggctcgaaaggaggctcttccagcaactcttc
gcgaccaaggaccagaaggaaggtatggctgcttttgccgagaagaggaagcctacttgg
tccgacaagtaa

DBGET integrated database retrieval system