KEGG   Cryptococcus neoformans B-3501A: CNBH0400Help
Entry
CNBH0400          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    CNBH0400
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     CNBH0400
Protein kinases [BR:cnb01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   CNBH0400
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 426 aa AA seqDB search
MDNTPRHLFQTPNNVYILQQPWQFVKELGQGAYGCVSSARNSSTGETCAVKKVTNVFQKK
ILTKRCLRELRLLHHFRGHKNITCLYDMDIVFDPPGSGQFREVYLYEELMEADLHAIIRS
GQPLSDAHFQSFLYQTLCGLKYIHSANVLHRDLKPGNLLVNADCELKICDFGLARGFQPG
AVQTDQGQAGFMTEYVATRWYRAPEIMLSFANYTSSIDMWSVGCILAELLGGKPIFKGED
YVDQLNKILNLLGTPTEDTLRRVGSPRAQDYIRSLPIKPRVKFETLYPNASPLALDLLSK
LLTFDPAKRYGCEEALEHQYLAVWHDPADEPLCEVPFDFSFEEEDSVSGMRDLILEEVRS
FRYLVRQQSMPPARKDSHELPPAPPAPQHPGAGVGPAFHERANSEGDMEEHPGSALEKQL
ERQKLS
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggacaacactccccggcaccttttccagacacccaacaacgtctacattcttcagcag
ccatggcagtttgtcaaagaactcgggcaaggagcgtacggttgcgtgtcttctgcgaga
aactctagtacgggagaaacatgcgcggtgaaaaaggtaacgaatgtgtttcaaaagaag
atcttgacaaagcggtgtctgagagagttgaggttgttacatcacttcagagggcataaa
aatatcacctgcttgtacgacatggacattgtctttgaccctcctggatcaggacaattc
cgtgaagtctacttgtacgaagagctcatggaggctgatttacatgccattattcgatct
ggacaacctctttccgatgcgcacttccaatcattcttatatcaaactctctgtggtctc
aagtacattcactctgccaacgtcctccaccgagatctgaaacctggaaaccttctcgtg
aatgccgattgcgagctcaagatttgtgatttcggtttagctcgtggtttccagcctgga
gcggtgcagacggatcaaggtcaagccgggttcatgactgaatatgtcgccacaagatgg
tatcgagcccccgaaattatgctttcatttgccaattacacttcaagcatcgatatgtgg
tctgttggatgtatcctcgccgaacttcttggcggtaaacccattttcaagggtgaagat
tacgtcgatcagctgaacaagatcctcaaccttctcggtacccccactgaagacactctc
cggagagttggttcgccaagagctcaggattacatcaggagcctgcccatcaagccgcgc
gtcaagtttgagacattgtatcctaacgcatctcccttggcgttggatttgttgagcaaa
ctgttaacatttgaccccgccaagagatatggctgcgaagaagccctagaacaccagtat
cttgcggtatggcacgatcccgccgacgaacccctttgcgaagtcccgtttgacttttcc
tttgaagaagaagattccgtcagcgggatgagggatttgatcctcgaagaggtcaggagt
ttccgatacctcgtgaggcaacaatctatgcctcccgccaggaaagactctcatgagctt
cccccggctcctcctgcacctcaacatcccggtgccggcgttggtcccgccttccacgaa
agagcgaacagcgaaggcgatatggaggaacaccctgggtccgcattggagaaacagttg
gagaggcagaaattatcatag

DBGET integrated database retrieval system