KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBH0530Help
Entry
CNBH0530          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K13501  anthranilate synthase / indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.3.27 4.1.1.48 5.3.1.24]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Pathway
cnb00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cnb01100  Metabolic pathways
cnb01110  Biosynthesis of secondary metabolites
cnb01130  Biosynthesis of antibiotics
cnb01230  Biosynthesis of amino acids
Module
cnb_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CNBH0530
Enzymes [BR:cnb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     CNBH0530
   4.1.3  Oxo-acid-lyases
    4.1.3.27  anthranilate synthase
     CNBH0530
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     CNBH0530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IGPS PRAI GATase Peptidase_C26 His_biosynth FMN_dh QRPTase_C YjeF_N
Motif
Other DBs
NCBI-GeneID: 4937569
NCBI-ProteinID: XP_774006
UniProt: P0CN87
Position
8
AA seq 752 aa AA seqDB search
MGFTLLIDNYDSFTWNIYADLASVGGNPYVVRNDKITLKEIEGMFSDGELERIVISPGPG
HPRTDSGVSRDVIAWGMGKLPILGVCMGLECIVDLLGGEIAYAGEIKHGKTSLVQHDSIG
VFHNLPQFLSSTRYHSLSAQIQSLPSVLQVTSTTKESGVIMGVRHRTYTVEAVQYHPESC
MSEGGRGLMANFIQMKGGKWGGENAWCGVPAEGEEEQPKAKTNGAPSLPTILNRIHAQRL
LDVEQAEKVPATSPANVSTSLSLYASPPLINFRDRMVSTPHTAVMAEIKRASPSKGDIAP
TASAPEQALKYALAGASVISVLTEPTWFKGSLLDMLAVRNAVDSLPNRPAILRKDFVLSK
YMIDEARLYGADTVLLIVAMLEPQQLKELYDYSVSLGMEPLVEVNNPTELSLALEIGSKV
IGVNNRNLHDFNVDMSTTSRVNAALNGRDVVLCALSGISSHEDVEKYVKEGVKGVLVGEA
LMRASDTKAFLRSLIGLPPLEVVPKSRPLVKICGIRSTDDAKLAISAGADLLGVILVPGT
KRCISTSTAREISALVQSARSQSSSKPLEPSLSSPWFTTQSDLLSSRRKPLLVGVFQNQS
LSDILSAVEEIGLNLVQLHGDEPQAWAKFIPVPVVKVFRVSPEGIVRGGEIRRPGLNQAI
LLDAGGVSGGGGEGKAFPWEHAKRLIQSGEVGSEGHMPLPVILAGGLTPENVGQAIEQAG
EGVWCVDVSSGVEGEGGKVKEKVEAFVKAVRG
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgggctttactctccttatcgacaactatgactctttcacttggaacatttacgccgat
ctcgcttctgtcggcggtaacccctatgtcgtccgtaatgataagattacccttaaggag
atcgaggggatgttttctgatggcgagcttgagcggatcgtcatatctcccggtcctggg
catcctaggacagactctggtgtctctagggacgtgatcgcttggggaatgggcaagttg
cctattttgggtgtgtgcatgggtctggagtgtattgttgatctgctcggtggagagatc
gcttatgccggtgaaattaagcatggtaaaacctcgcttgtccagcatgactctatcggg
gtcttccacaacctcccccagtttctctcttctactcgataccattccctttccgcccaa
attcagtcgcttccttcagtcttgcaagtcacttcgactaccaaagaatctggtgtgatc
atgggtgtacgacacaggacctacaccgttgaagccgtgcagtatcatcctgagagttgc
atgagtgaaggcggtcgaggcttaatggccaatttcatccaaatgaagggcggcaaatgg
ggtggcgaaaatgcttggtgtggcgttcccgcggagggcgaggaggagcagcccaaggcg
aagaccaatggcgctccaagcttgcctactattttgaataggattcacgcgcagaggtta
ttggacgttgagcaagccgaaaaggttcctgctacaagccctgccaacgtctctacctct
ctttccctctacgcttctccacctctgatcaactttagggaccgtatggtctctactccc
cacactgccgtcatggctgagattaagcgtgcttctccctccaagggcgatatcgctcct
accgcttccgctcctgagcaagcactcaagtatgctcttgccggggcttccgtcatctcg
gttctcacagagcctacgtggttcaagggcagcttgcttgacatgctcgctgtgcgcaac
gctgttgatagtcttcccaaccgtcctgccatcttgcgaaaggattttgttttgtccaaa
tacatgattgatgaggctagattatatggcgccgacactgtgcttctcattgtcgccatg
ctcgagcctcagcaacttaaggaattgtacgattactctgtctctcttggcatggaaccc
ctcgtcgaggtcaacaaccctaccgagctctcactcgcccttgaaattggttccaaggtc
attggtgttaacaatcgtaatctacatgactttaatgttgacatgtccaccacttctcga
gtcaacgccgctctcaacggacgggacgttgttctttgcgctttgagcggtatttcgagt
cacgaggatgttgagaagtatgtcaaagaaggtgtcaagggtgtgcttgttggtgaggct
ttgatgcgagcaagcgacactaaggctttcctccggtcgcttattggcttaccgccttta
gaagtcgttcctaagtccaggccgctcgtcaagatttgcggtatccgttctacagatgac
gctaagcttgcaattagtgccggtgccgatctccttggtgtaatccttgtccccggtacg
aaacgttgcatatccacttctaccgcccgcgaaatttctgctcttgtgcaatccgcccga
tctcaatcctcttccaagccattagaaccttctctttcctccccttggtttaccacccaa
tccgacctcctctcatcccggcgcaaacccctactagtcggtgtcttccaaaatcagtct
ctctccgacatcctctcagccgtggaggagattggcctcaaccttgttcaactacacggt
gatgaaccccaagcctgggccaagttcatccccgtgcctgtggtcaaggtgttccgagtt
tcgcctgaaggaatagttagaggtggtgagatcaggcggccaggtttgaaccaagcaatc
ttgctcgatgctggtggtgtgtctggcggtggtggggaaggaaaagccttcccttgggaa
catgccaagcggctcatccaatctggcgaggtggggtctgaaggtcatatgcctctccct
gtcatcctcgctggtgggttgacgcctgagaatgtgggccaggcaattgaacaagctggt
gaaggcgtttggtgtgtggacgtcagcagtggggtcgaaggagaaggaggaaaggtcaag
gagaaggttgaggcgtttgtgaaggccgtaaggggttga

DBGET integrated database retrieval system