KEGG   Cryptococcus neoformans B-3501A: CNBH0610Help
Entry
CNBH0610          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.4.19.12]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CNBH0610
Peptidases [BR:cnb01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   CNBH0610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 987 aa AA seqDB search
MVKALPKPCQDWDWVGTEVRTPGQITLEHRRRAAGLVTSVVCPRDLTHLGRETTKDDSEV
KGNGKGTGEKKGTGCRAKNCKSNYMCYNNLGTEKLLEPDAKAEFVISNLGDVPQERNGPA
GLRNLGATCYANAFLQLWFHNVPFRNAVYACVTTETTPLYQLALIFAKLEYGEKNVVDPM
GLIDALRLNMGDQQDAAEFSKLFMSLIASEFSKHSDPKLKTLVKDQFEGTMQYITQCECG
YESISETTFLEIELSLKDNTTLQSRLDEFTCPEILDGDNKYSCPSCLSKRRATRRQLPVT
LPPVIHFSLLRFVFDLKSMSRKKSKASIKYPKEAVLGNSVYELKGIISHQGTSAYHGHFV
CETYDESNDTWYICNDELVQPKPVRPHKKIKLEKPGDDKGKLESSKDAYMLVYKRRDGHV
SPQFPPAIVMEKVKEENRGLREELNKVGVRKEVLEDEWEHLKGAKVDTDYIVPRDALAKW
IQSPSFQDLYKPFDYSSILCAHSQVDPLKSSDIRTISALAHDKLLLYTSLPEIDVCLICV
AEGFVARSSITEQQSALEAFDELNAKAELEEGGEEERWCLPKTWLIHWRTGKLPPQTLPT
HSSYTLLCPHNAPLPSSSAPPVTFITSSALSLLHSIFGSFPSFQPGTPPCPECSFEADQN
AESLAQWKTDVKLDKSIKRHLDPRPPAFGLDYYVLPKEFIEKWEVYMKTPGGEKPELDMG
LGRGRCEHGLLDWDPQMEKPRVISEIGWEMLCQKYGEKEPIKVQFGANPPEGKKVNIASF
TPAVCEPCRIIRLSSYDELEIPIVFAPGPPTSYSTPASTGNTSGSKSGSGSSRNTSRTLR
SRLKTLYIQATRQSTIKDLKVSILSQTGITPLLQKIYYKRRTQPQEQEECSGKGNEEEKE
LDNDLTIGKLGYLKGEELILVEVKEEGNLDDDDDIVDGGNGGKGKNGKNEGFGGTALLAR
IACPDCTYENDGAAECCEMCMRPFKYD
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atggtgaaagccttgccaaaaccctgccaggactgggactgggtcggtacagaggtccga
acgccaggtcagatcacgctcgaacatcgacggcgtgcagctgggcttgttacaagcgtc
gtttgtcctcgcgacctcacacaccttggaagagagactaccaaggatgatagtgaggta
aaagggaatggaaaaggaactggggagaagaagggcacaggatgtagagcaaaaaattgc
aaatcgaattacatgtgttacaataaccttggaacggaaaagcttttggaacctgatgcg
aaagcagaattcgttatttcaaacctaggagatgttccacaagagcgtaatgggcccgct
ggtttaagaaacctcggggcgacgtgctatgcaaacgccttcttgcaattgtggttccac
aacgtgccttttcgtaatgcagtctatgcttgcgtgactacagagaccacaccactctac
caattagctctcatcttcgctaagctggaatatggcgaaaagaatgtagtggatcccatg
ggtctgatagacgctctgcgactcaatatgggtgatcaacaagatgcagccgagttctca
aaactgttcatgtcattgatcgcatcagaattctcaaaacattccgaccctaaactcaaa
acgttggttaaagatcagtttgaagggacaatgcagtatattacccagtgtgaatgtggg
tacgaaagtatctctgagaccactttcctcgagattgaactctcgctgaaagacaataca
acccttcaatcccgcctggacgaattcacatgccctgaaatccttgatggggacaacaaa
tactcttgcccctcctgcctctctaaacgccgtgcaacccgtcgtcagctgcccgtcacc
ctccctcccgttatccacttctctcttctcaggtttgtcttcgatctcaaaagcatgtcg
agaaagaagagtaaagcgtcgataaagtatccgaaagaggcggtgcttgggaattcggta
tatgaattaaaaggaattatatctcatcaagggacaagcgcgtatcatggtcatttcgtt
tgcgagacatatgatgaaagcaatgatacctggtatatctgtaacgacgagttggtgcag
cctaaacctgtccggccgcacaagaaaatcaagcttgagaaacctggcgatgacaagggc
aagttagaatcatccaaagatgcctacatgctcgtctacaaacggcgagatggccatgtg
tctccccaatttccaccagcgattgtcatggagaaggttaaggaggagaatagagggttg
agggaagaattaaataaagtgggggtgaggaaggaagttttggaagatgagtgggagcat
ctaaagggggcgaaggtggatacagactacattgttcctcgcgacgccctcgccaaatgg
atccagtctccctcctttcaagatctctacaagccattcgactactcatccatcctctgt
gctcattcgcaagtggatcccctcaaatcttctgatatacgtacaatatccgcgctagct
catgataaacttttgttatatacttctcttcccgagatcgacgtctgcctaatatgtgtt
gcggaaggctttgtcgcaaggtcgagtataacggagcagcagtcggcgcttgaggcattc
gacgaactcaatgccaaggccgagttggaagaagggggtgaagaagaacggtggtgtctt
cccaaaacgtggctcatccactggcgaacaggcaaacttcctcctcaaaccttgcccaca
cactcttcctacaccctcttatgcccccacaacgcccccttaccttcatcttccgccccg
cccgtcaccttcataacctcctctgccctttccctcctccactccatctttggctccttc
ccttcgttccaacccggaacacccccctgccccgagtgttccttcgaggcagaccaaaat
gcagaatcgttggcacaatggaaaacggatgtgaagcttgataaatctatcaaacggcac
cttgacccgcggccgcctgcttttggattagattattatgtacttccaaaagagtttatt
gagaaatgggaggtgtatatgaagactccagggggggagaagccagagttggatatgggt
ctgggacgagggagatgtgagcatggattgttggactgggatccgcagatggagaaaccg
agggtgattagtgagatcggatgggagatgctttgtcagaagtacggtgagaaagagcca
attaaagtacaatttggtgccaaccccccggaaggaaagaaagtgaacattgcttctttc
actcctgctgtctgcgagccatgcaggattatcagattatcatcatacgacgaactcgag
ataccaatcgtcttcgctcctgggccgcccacatcttacagcacccccgcctctacaggc
aataccagcgggtcaaagtcaggatcaggatcaagccgtaacacatcaaggaccctacgg
tcccggcttaaaacgctatacatccaggccacgagacaaagtacaatcaaggatctcaaa
gtatccattctttctcaaacaggaatcaccccgcttctccagaagatttattacaaacgt
cgaacccaaccccaagagcaagaggaatgttcggggaaagggaatgaagaagaaaaagag
ctagataatgatttgacgattggcaagctgggatatttgaaaggggaggagttgatattg
gttgaagtgaaagaagaagggaatctggatgatgatgatgacattgtagatggaggtaat
ggaggcaagggaaaaaatggaaagaatgaaggattcggagggacggcattgttggcgagg
attgcatgtccggattgtacttatgaaaatgatggggcagcggaatgctgtgagatgtgc
atgagaccatttaaatatgattga

DBGET integrated database retrieval system