KEGG   Cryptococcus neoformans B-3501A: CNBH1180Help
Entry
CNBH1180          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CNBH1180
Protein kinases [BR:cnb01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   CNBH1180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 1404 aa AA seqDB search
MDSPKMSSSDSSKMDSPKMDSPKSPVLPRLESILPPSPGSARSRIYARRQERANAAASIS
QLPGPSQSLQPPQTLQPLKPPPPPGFADSQTFSQRASRDSRKTPPNPSRHNPSHDILKQF
AVKDFSHLPPSPSSASINQFLRASGSTQNISSGTPPGSASASNAYFPSKGVQREDSQKSQ
KSQKQQRTTPKPKELDPNVDEALRKLDGLTGTPGKNKAKGKSSGGPSAASSRPGTPVAES
KSRSEGKIPSKPSIGSFKDATGSPLSNWIDLTEDLPAIPIPRARIPPNRESSSSASVTGT
PNSHDSQSLPTTATTMSSADLASSSNKPRRASGGSDTFAAQAGVHVDQPEETEKSVPPVP
PLPQVYVNKKQSMPAQSSAMRPPSYVPMREPSPEPPAVSSPFEPGSPSTTAPVPVPAQPK
MHKKWSFSSALNLKSAASSASSVDEMRMTTPQKSPDAMGATPLAPPSSKASNVNKRLTPS
SIPFFRRSSSSSFQSKASQSVAPLPVPLPETPKQTEKTAAVPSSQSRKSVLGMHFPSMLR
GSSSKRGLAQQTSQSQVSAKGKEEVKPTSAPSASATSGWTGRKRGKVRTLSISGDLPNPF
PGLKHQSSADSSFGTRGSAVSSNSDATTISGSNTFDRLPAIMGSPARPPEGARYSNSPRN
LPSTTPTKIPRMTQRPAPSPATVTAHSGMPPPPFPTTRKISNTVSGAGEQQQRGGPPVSE
FGMVDGIPHMPTTPRLTTSGAHRAHLLAPMSARQETRRVNNRPFDPPPRSKEAYTGAVPP
SRRHLPQPPPASTVTSMTLSASAKRASREFKNKRRESKDGQDGSSSGKNSPVKPSKSMHS
SMAVPSSSRLPSSYSAGTPGSNYRKLSLADSSPSMSPADDDEASGDAEMEAYIKRRRERA
AANKKDDLSDVTEFPRDITPVEPLSQRAFITRNLAKMSDAERKEVLDFDYIYYSPTPGTI
RRPSQPGGAMFNHGYDDERGDYLVVEGDHLCYRYEVVGILGKGSFGQVVQCRDHKTGKSV
AVKIIRNKKRFHTQALVEVKILQQLIEWALQDPEDKHFMVRMTDSFSFRNHLCIVTELLS
INLYELIKANHFAGFSTVLIRRFTTQMLGSLQLMRSHRIVHCDLKPENILLCHPSKSAIK
VIDFGSSCLETEKVYTYIQSRFYRSPEVILGMNYAMAIDMWSLGCILAELYTGVPIFPGE
NEHEQLACIMEVLGVPDRYLIEKASRRKNFFDATGAPRPFVNAKGRRRRPGSKTLAGVLK
CDDELFVDFIARCLTWDPDKRLKPQPAMRHPWILAGRRRYAPTPSRDEKRATTTERSSRL
FGTSHTSTRISSKNLSELSTSSMKDKDKSKLLISSPVPLAPAKHPYHASTASTSRIGQAM
SSSRLAHQTSARSGSLTTSKLSIG
NT seq 4215 nt NT seq  +upstreamnt  +downstreamnt
atggactcgccaaagatgagctcgtcggactcgtcaaagatggactcgccaaagatggac
tcgccaaagagcccagtcttaccccgactagaatccatactccctccttcgccggggagt
gctcgttcgcggatatacgctcgtcgtcaggaacgagccaatgcagcagccagcatttct
caacttccgggtccttctcaatctctccagccacctcaaacacttcaaccactcaagcca
cctccacccccaggctttgccgattcccagacattttcacagcgcgcgagtcgtgatagc
agaaaaacccctccaaacccctcgcgccacaacccttcccacgacatcctcaagcaattc
gccgtcaaggacttttcgcaccttccacctagtccatcatctgcctcaatcaatcagttc
ctccgcgcaagtggctccacccaaaatatctcttccggcactcctcccggcagcgcgtcc
gcctcaaacgcctactttccatccaaaggcgttcagcgtgaagactctcaaaaatcgcaa
aagtcccaaaaacagcaacggacaacgccaaaaccgaaagagctggatccgaatgtcgac
gaggcgctgaggaaactcgatgggcttaccggcacccccggaaagaacaaggcaaagggg
aaatcatcaggcggtccctctgctgccagttcacgccctggtacccctgttgccgaaagc
aagagcaggtctgaaggcaagatcccttctaaaccaagtattggctccttcaaggacgct
acgggttccccactcagtaactggattgacttgactgaagatctccccgccattcctatt
ccacgcgcacgtatcccgcccaatcgcgagtcctcttcctctgcgagcgtaaccggtacg
cccaattcgcacgactcacagtccttgcccactacagcgacgaccatgtcttccgccgat
ttggcgagcagcagcaacaagccgcgacgggccagtggagggagtgatacgtttgcagca
caggccggagtccatgtagaccagcccgaagagacggagaagagtgttccgccggtaccc
ccgcttccccaggtgtacgtcaacaagaagcagagcatgcccgcacagtctagcgccatg
cgaccgcccagctacgtgcccatgcgtgaaccttcacccgagccgcctgctgtatcttca
ccttttgaacccggatcaccatcgactaccgcacccgtgcccgtgcccgcccaaccaaag
atgcacaaaaagtggtccttctcctcggcgctcaacctcaaatcggcggcatcgtctgca
tcctcggtggacgagatgagaatgacgacaccgcaaaagtccccagacgccatgggtgca
acacctctcgcaccgccttcatcaaaggcttccaacgtcaacaaacgcctcacgccttct
tcgatccccttcttccgccgatcctcatcctcttcattccaaagcaaggctagtcaatcg
gtagcgcctctgcccgtgccgttgcccgagacgcccaaacagactgagaagacggccgcc
gtcccaagctcccagtcgcgcaagtcggtgctggggatgcatttcccgtccatgcttaga
ggaagctcgtcaaaacgcggtctggcgcagcaaacgagtcaatcccaagtttctgcaaag
ggaaaggaagaggtcaagcctacaagtgcgccgagcgcgagcgcgacgtcggggtggact
ggccggaaacgtggaaaggtgaggacactctccatatctggagatcttccaaacccattc
ccaggcctcaagcaccagtcttcagcggacagctcctttggaacccgtggttcagcggtt
tcaagcaatagcgatgcgacgaccatcagcggcagcaacacatttgaccgtttgcctgcg
ataatgggctcgcctgctcgacctccggaaggtgcgaggtactccaactctccgagaaac
ttgccttccaccacgcctaccaagattcctcggatgacccaacgcccggctccatcgccg
gcgactgtgaccgcccacagcgggatgccgcctcccccattccctacgaccaggaaaatc
agcaacaccgtatcgggcgcaggcgagcaacagcagcgcggcggtcctcctgtatcagag
tttggcatggtcgacggtataccacatatgccaacgacgcctcgcctgactacttcaggt
gctcaccgagctcatttgcttgctcccatgtcggcccgacaagagacgcgtcgcgtgaac
aatcggccttttgatccgcccccacgcagcaaagaagcgtacaccggcgccgtcccgcct
tcgagaaggcacctccctcaaccaccgcccgcatcgactgtcaccagcatgacgctttcc
gccagcgccaagcgcgcaagccgagagttcaagaacaagcggcgggaatccaaggacgga
caggacgggtcctcctctgggaaaaactcgcctgtcaagccatcaaaatctatgcactca
agcatggctgtgccgagctcttcccgcctgccttcttcctattccgctggtactcccggt
tcgaattaccgcaagctgtctttggccgactcgtcgccctcgatgagtcccgcggacgat
gatgaagctagtggagatgcggagatggaggcttatatcaagaggcgacgagagcgcgca
gcggcgaataagaaggatgacctgtcggatgtgaccgagttcccgagggatatcacccct
gttgagcccctctctcagcgcgcgttcatcaccaggaaccttgcaaagatgtctgacgca
gaaaggaaggaggtgctcgatttcgactatatctattacagtcccaccccaggtacgatc
cgtcggccgtctcagccgggaggagccatgttcaatcacggatatgatgatgagcgaggt
gattatctcgtggtggagggtgatcatctttgttataggtacgaagtggtaggtattcta
ggtaaaggatcgtttgggcaggtcgtccaatgtcgggaccataaaacgggcaagtcggta
gcagttaaaatcattaggaacaagaaacggttccatactcaagcgctggtggaagtcaag
atcttgcagcagttgattgaatgggctctgcaggaccccgaagacaaacatttcatggtc
cgtatgactgatagcttttctttccgcaaccatctctgtatcgtcacagagctcttgagc
atcaatctttacgagcttatcaaagcaaaccactttgccggcttttcgacagtgctcatc
aggaggtttaccacccagatgctgggttccttgcagttgatgagatcacacaggatcgtt
cactgtgacttgaagcccgaaaatatcctgctctgtcacccctcgaagagcgcgatcaag
gtgattgattttggaagcagttgcttggagacagagaaggtttacacttatatacaatcc
cgcttctatcgaagtccagaagttattctcggcatgaactacgccatggcgattgacatg
tggtctctaggctgcattcttgccgagctctatacaggtgttcccattttccccggggaa
aacgaacacgagcagctggcctgtatcatggaagtcctcggtgtgcccgatcgctatttg
attgaaaaggcatcacgacgtaaaaactttttcgacgctaccggtgcacctcgtcctttc
gtcaatgccaagggtcgacgacgacgtcctggatccaagaccctagccggcgtcctcaaa
tgcgatgacgagcttttcgtcgatttcattgcccgctgtctcacttgggatcccgataag
cgcctcaaacctcaacccgctatgcgtcatccttggatcctggcagggcgaaggcgttac
gcgccaacacctagccgcgacgaaaaacgtgccactactactgagcgatcttcgcgattg
ttcgggacctcacatacgtcgacaagaatcagttcgaagaatctctcagaattatcaact
tctagcatgaaagacaaggataaatctaaactcctcatttcctcgccggtgcctttggcg
cctgcaaagcacccatatcacgcctcgaccgcttcgacatcaaggattggccaagccatg
agctcttcaaggcttgctcatcaaacttctgccagaagtggctctctcactacctcaaaa
ctcagcattggctaa

DBGET integrated database retrieval system