KEGG   Cryptococcus neoformans B-3501A: CNBH1310Help
Entry
CNBH1310          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    CNBH1310
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     CNBH1310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 519 aa AA seqDB search
MVVTPTRPPVEPSGPPLSPLALASTAPRNSSDSYFAAQAGSRPLPRHRRTSGSSFSKLSE
FSLDPPLLDKTDQYAASPDQIDENGVTGVRHVALSVDASEWRQPVFKQKVLAILRRLHVP
RWSSTLLTPTNIHLQKVSGALTNAVFFVSFNPAPNPTSPSESPLLTPTIPPSDPSHPPPL
TPDQYPHTLLFRVYGPSSEALISRSEELRILHVLSTQYGIGPRVFGTFTNGRVEEFFPSR
ALTAQELRDPSISRGIARRMRELHSVDLRRLGYEQGRATEPALWICLKEWSEAAEDVITS
LTALGGTLEAWVERFSLHRIREEVTIYRNFVESQSGKGSGVVFAHNDTQYGNLLRLDVEL
PPNTPEHCRYIVIDFEYASPNPRGYDIANHFHEWRANYHHPTHSHSLIPHFPYPTPIQRE
DFYRSYLSVEVDGRNGEEVVGKRKDVPADKVAALEREVRIWSPGCSINWALWGLVQAEEQ
VCALATKKEGYVPEFDYLSYAAERLEMFRDEAKKLGVPL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggtggtcacccccacccgtccccccgtcgagccatccggcccccccctctcccccttg
gcactcgcctccactgccccccgaaacagctcggactcatacttcgccgcccaagccgga
tcaaggccgctgcccaggcacaggaggacatcaggaagcagcttctcaaagctgtccgag
ttcagcttggaccctccgcttctcgacaaaacggatcagtacgctgcctcgcctgaccag
atcgatgaaaacggcgtcacaggcgtccggcatgtggcgctgagtgtggatgccagcgaa
tggcggcagccagttttcaagcaaaaagtcctagccatcttacgacgccttcacgtcccg
agatggtcctctacactcttgacacccaccaacatccatcttcaaaaagtctcgggggcc
ttgacaaacgccgtcttctttgtctctttcaatcccgctcccaacccaacttcgccttcc
gaatcgcccctgctaacccctaccattcctccatctgatccatcccaccccccaccgctc
actcccgaccagtacccccacacccttctcttcagagtctatggcccttcctctgaggca
ctcatctcccgatcggaagaactacgtatactccacgtccttagtactcaatatggcatt
ggccccagagtttttggcacttttaccaatggccgggtcgaggaattcttcccatcacgc
gctttgaccgctcaagagttacgcgaccccagtatttctcgtggcattgcccggcggatg
cgcgaacttcactcggtggacttgcgtcgcttgggatacgaacaaggtcgcgctacggag
cccgctttatggatatgtctcaaagaatggtctgaagcagcggaagatgtcatcacctct
ttgacggccctcggcggaacattggaagcatgggtagagcgtttctctttacatcgtatc
cgggaagaagtcacaatctaccggaactttgtagaatcgcaaagtggaaagggcagtggc
gttgtgtttgctcacaacgacacgcagtatggaaatctgttacgcctcgatgttgagctt
ccgcccaacactcccgaacattgccgttatattgtgattgactttgaatatgcttctccc
aacccccgtgggtacgatatcgccaaccatttccacgaatggcgagccaattaccaccat
ccaactcattctcactccctcattcctcatttcccctaccccacacctattcagcgtgaa
gacttttatcgatcatacttgtccgtcgaagttgacggaagaaacggcgaagaagtggtg
ggcaaacgcaaggatgttccagcagacaaggttgctgctcttgaacgtgaagtaaggatt
tggagcccggggtgcagtataaactgggcgttgtggggtttggttcaagctgaagaacag
gtctgtgccttggccacgaagaaggaagggtatgtcccagaattcgattatctctcgtac
gccgctgagcgacttgaaatgtttcgggacgaagccaagaagcttggagttccgttatag

DBGET integrated database retrieval system