KEGG   Cryptococcus neoformans B-3501A: CNBH1340Help
Entry
CNBH1340          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K06634  
cyclin H
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    CNBH1340
  Replication and repair
   03420 Nucleotide excision repair
    CNBH1340
Transcription machinery [BR:cnb03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     CNBH1340
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 447 aa AA seqDB search
MALSGQATPSEAGPSKSSLIPGPSAYHESSQFRHWRFSPSTLNRIRSELNTKSVEVARRN
TELEKEAQKSLGHDIADPPPAATYLTVNDELLLLRFYCSQVSRICREGFGLPEVVESTAI
SYVKRFYLKNSVMEWHPKIIMPTCLYLAAKTTNFPIPADQFVSKIPKLTPEDVLEKEFLV
AQSLSFEFWVRGADKALRGWTLDMQDQQNPPLEAIQKAIAPAFTHLSTSYLSDAEFIFTP
SQISLACLRMADRKLVEGFLEERYAAHAAAIASKSMNGVEESENGTPVQGPAPLYGMEKV
RLLEILDQIEAIIRAVAVELDVKKVKEVDKRLRQCTNPEKIPGTALYVKRKQEKEAADAA
AKATKTLKSQSSAADSDMFFGGSLPLANGQSKSRVPLSPRVNLNSNQKAGGAEMEISDTG
MGIQGESGGLLMGGKGLKDVGLPLSKD
NT seq 1344 nt NT seq  +upstreamnt  +downstreamnt
atggccctttcgggacaagctacaccctcagaggccggtccatcgaagtcttctctgatc
ccaggtccttcggcttaccatgaatcttcacaattccgtcactggcgcttttccccgtcg
actttgaatagaatacggtcagagttgaataccaagtcggtcgaagtggctaggaggaac
acggaactagagaaggaagctcagaaatcactagggcatgacattgccgatccaccacca
gccgcaacttatcttacagtcaacgacgaacttttgcttctccgcttttactgttcacag
gtatctaggatctgccgggaaggctttggtcttccagaggtggtagaatctacagcaatc
agttatgttaagaggttctacctcaagaacagtgtcatggaatggcatcccaagatcatc
atgccaacgtgcctttatctagctgccaaaacgacaaattttccaatcccagcggaccaa
ttcgtgtccaagatcccgaaactcactccggaagatgtcttggagaaagagtttctggtc
gctcaaagcctgtcgttcgagttctgggtgcgtggggcggataaggctttgagaggctgg
acattggatatgcaagatcaacagaatccgccactagaagcaatccaaaaggccatcgca
ccagcttttacacatctctccacatcctacctttcagatgccgaatttatcttcacacct
tcacaaatatctttagcttgcttgaggatggcggacagaaagctggttgagggctttttg
gaagagcggtatgctgcccatgcggctgcgatcgcttcaaagtcaatgaacggcgttgaa
gaaagcgagaatgggacaccagttcaggggcctgcacctctatatggtatggagaaagtc
aggctcttggaaatccttgaccaaattgaagccataatccgggcagttgccgtcgagttg
gatgtcaagaaggtgaaggaggttgataagcgattgagacaatgtaccaaccctgaaaag
atcccgggaactgccttatatgtcaagcgaaagcaagagaaagaagcagcagacgcagca
gctaaagcaactaaaacactcaagtctcaatcttccgccgcggatagcgacatgttcttt
ggtggttctcttccattggccaacggtcagagcaaatcaagggtccctttgtccccccga
gtcaacctcaatagtaaccaaaaggctggaggcgctgaaatggaaataagcgacacagga
atgggtattcagggggaaagtggagggctgctaatggggggcaaagggttgaaggatgta
ggcctaccattatcgaaggattag

DBGET integrated database retrieval system