KEGG   Cryptococcus neoformans B-3501A: CNBH2300Help
Entry
CNBH2300          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Purine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CNBH2300
  Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    CNBH2300
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.3  With oxygen as acceptor
    1.7.3.3  factor-independent urate hydroxylase
     CNBH2300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 311 aa AA seqDB search
MSHPGYLSAARYGKDLVKVARVVRDGEQHHIVEYTLRVLLEGEIETSYTEADNSCVVATD
TVKNTCNIFAKTSPYVLDAPVFALHLGLHFVTKYKHIHKCFVDIIGLKWSRISVDGKPHK
WSFIRDGDEKAIVECVVDGTAGPDAATANVKIGIKDLLVLKTSGSAFENFHRDENTTLAD
VADRIFSTSVSLQCSISLPPNTPLTIDNLGSIAKELDFPKMKELILKDVLDTFATDESAS
VQATLYLTLQKILASCPAVKDASMQLPNKHYIPVNLSAFGLDNKLGYEGGAEVFYPAADP
SGYITATVTRK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgtctcatcctggttacctctccgctgctcgatacggtaaggaccttgtaaaggtcgca
cgagtcgtccgtgatggtgagcaacaccatatcgttgagtacaccctccgagtcctcctt
gaaggcgagattgagacctcttacacagaggccgacaactcctgcgtcgttgctaccgac
actgtgaagaacacttgcaacatctttgccaaaacctccccttacgtccttgatgcccct
gtctttgccctccatcttggtttgcactttgtcaccaaatacaagcacatccataagtgt
tttgtggacataattggccttaagtggagccgtatctctgtcgacggcaagcctcacaag
tggtccttcatacgagacggtgacgaaaaggcgattgttgaatgcgttgtggatggcact
gccggccccgacgctgccaccgcgaacgtgaaaattggtatcaaggatcttcttgtttta
aagacgagcggatcagctttcgaaaacttccaccgagatgagaataccactcttgctgat
gttgcagaccgtattttctctacatccgtctctctccaatgctctatttcccttcctcct
aatacccctctcaccatcgacaaccttgggtctattgccaaggaactcgatttccctaag
atgaaggagcttatcctcaaggatgtcctcgacacttttgctaccgacgaaagcgctagt
gttcaagctactctttacctcactctccagaagattttggcttcatgccctgccgtcaag
gacgcttctatgcagttacccaacaagcactacatacctgtcaaccttagtgcttttggc
ttggacaataaattgggttacgaaggtggtgctgaggtcttctaccctgctgccgatccc
agcggttacatcacggccactgtcaccaggaaataa

DBGET integrated database retrieval system