KEGG   Cryptococcus neoformans B-3501A: CNBH2850Help
Entry
CNBH2850          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    CNBH2850
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     CNBH2850
Protein kinases [BR:cnb01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   CNBH2850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 563 aa AA seqDB search
MDPPRASSTRSSSSSMPTSSSASASANKLKKFKLDPMSMLLPHERPGYRGSPAAGRSMPP
LHPQFQLQSQPGSPAYFAMLQSQQVQQDSGTQRIGIQTRTTAGVGEQGGKRGEGSGSQIP
TQVPVGSQHPAQGVPLSPPASMASTPPSGSWEDSASQWSSMEGVVEGTPAPGQRSQPSRH
YAPRMTQNKMRLEDWEIVETLGTGTFGRVLLVRQRPSYRPTPYHPIFPHLYRSRHPFSPS
PSTTQKSDDHLPHFAMKVLRKSEIVRLKQVEHINSERIILERVRHPFIVELHATYQDQIN
VSYIPGGELFSHLRRAGRFSADVTRFYLASIVLAIEYLHSQNIIYRDLKPENLLLDRHGY
LRIADFGFAKVVQDRTFTLCGTPEYLAPEIVLSQGHGKAVDWWALGILGFEMLAGYPPFF
DDHPLGIYEKILRGDIAFPSHVDPYAKDLIRGFLTADRSKRLGNLRGGAKDVMGHPWFAG
VDWRSLERKEIGAPIVPRVASMGDSQNFQRYPPPRPQDLPGVFGQTYNTSNDPCGELFSD
FSFPGGGSERGSASGSTEVLSRD
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggatccaccccgcgcatcctccactcgctcttcatcctcctcaatgcctacctcaagc
agcgcctcggcgtccgcaaataagctcaaaaagtttaagcttgatccgatgtcaatgctt
ttacctcatgaacgtccaggctaccgtggatctcctgccgccggtcgaagtatgcctccc
ctacatcctcaattccaactgcaatcccaacccggttcaccggcgtactttgcaatgttg
cagagccaacaagtacaacaggattctgggacacaaaggatcgggattcagacgcggacg
acagctggtgtgggtgaacagggtgggaagcgcggagaaggcagtggcagtcagattcca
acccaagttccagttggttcgcagcacccagcacaaggtgtaccgttatcgcctcctgcg
tcaatggcatcaactccaccgtccgggtcctgggaggattccgcctctcagtggagctca
atggagggtgttgtcgaaggcacgcctgcacccggacaacgatcccagcctagtcggcat
tatgccccgcgaatgactcagaacaaaatgaggttggaagattgggaaatcgtcgagact
ctgggtactgggacctttggacgagtcttacttgttcgacaacgaccttcttatcgaccg
acgccatatcaccccattttcccccatctctatcgctctcgccatcctttctcaccgtca
ccctctacaacgcaaaaatctgatgatcatctccctcatttcgccatgaaagtccttcgc
aagtcagaaatcgtgaggttaaagcaagtggaacacatcaactctgagcgaattatcctt
gagcgtgtacgacatccatttatcgtcgaactgcatgccacctaccaggaccagatcaat
gtgtcttacattccaggtggcgaactcttctcacaccttcgacgggccgggcgattctcc
gccgacgtcaccaggttctatctcgcgtctatcgttcttgccattgaatacctccattcg
caaaacattatctaccgtgatcttaaacccgaaaatctccttctcgatcgtcacggctac
ctccgcatcgcggattttggctttgccaaagtggtgcaagaccgtacattcactttatgt
ggtactccggaatatcttgctccggagatcgttctctcccaaggccatggcaaagctgtc
gactggtgggctcttggtatcctcggttttgaaatgcttgctggttatccccctttcttt
gatgatcatccgctcggtatctacgaaaagattctccgcggagatattgcatttccttca
catgtcgatccttatgccaaagatctcattagggggtttttgacagcggatcgaagtaag
aggttaggcaacttgaggggcggggcgaaggatgtaatgggacatccgtggtttgcgggt
gtggattggagaagcctagagaggaaggaaattggagctccgatcgtccctcgagtggct
agcatgggcgattcacagaatttccagcggtatccacctccccgaccacaagaccttcct
ggtgtatttggccaaacgtacaacacatcgaacgatccatgtggcgagctattttcagac
ttcagtttccctggaggagggagcgagagggggtctgcgagtgggtctactgaggtcttg
agtcgggattag

DBGET integrated database retrieval system