KEGG   Cryptococcus neoformans B-3501A: CNBH2850Help
Entry
CNBH2850          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
Organism
cnb  Cryptococcus neoformans B-3501A
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 563 aa AA seqDB search
MDPPRASSTRSSSSSMPTSSSASASANKLKKFKLDPMSMLLPHERPGYRGSPAAGRSMPP
LHPQFQLQSQPGSPAYFAMLQSQQVQQDSGTQRIGIQTRTTAGVGEQGGKRGEGSGSQIP
TQVPVGSQHPAQGVPLSPPASMASTPPSGSWEDSASQWSSMEGVVEGTPAPGQRSQPSRH
YAPRMTQNKMRLEDWEIVETLGTGTFGRVLLVRQRPSYRPTPYHPIFPHLYRSRHPFSPS
PSTTQKSDDHLPHFAMKVLRKSEIVRLKQVEHINSERIILERVRHPFIVELHATYQDQIN
VSYIPGGELFSHLRRAGRFSADVTRFYLASIVLAIEYLHSQNIIYRDLKPENLLLDRHGY
LRIADFGFAKVVQDRTFTLCGTPEYLAPEIVLSQGHGKAVDWWALGILGFEMLAGYPPFF
DDHPLGIYEKILRGDIAFPSHVDPYAKDLIRGFLTADRSKRLGNLRGGAKDVMGHPWFAG
VDWRSLERKEIGAPIVPRVASMGDSQNFQRYPPPRPQDLPGVFGQTYNTSNDPCGELFSD
FSFPGGGSERGSASGSTEVLSRD
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atggatccaccccgcgcatcctccactcgctcttcatcctcctcaatgcctacctcaagc
agcgcctcggcgtccgcaaataagctcaaaaagtttaagcttgatccgatgtcaatgctt
ttacctcatgaacgtccaggctaccgtggatctcctgccgccggtcgaagtatgcctccc
ctacatcctcaattccaactgcaatcccaacccggttcaccggcgtactttgcaatgttg
cagagccaacaagtacaacaggattctgggacacaaaggatcgggattcagacgcggacg
acagctggtgtgggtgaacagggtgggaagcgcggagaaggcagtggcagtcagattcca
acccaagttccagttggttcgcagcacccagcacaaggtgtaccgttatcgcctcctgcg
tcaatggcatcaactccaccgtccgggtcctgggaggattccgcctctcagtggagctca
atggagggtgttgtcgaaggcacgcctgcacccggacaacgatcccagcctagtcggcat
tatgccccgcgaatgactcagaacaaaatgaggttggaagattgggaaatcgtcgagact
ctgggtactgggacctttggacgagtcttacttgttcgacaacgaccttcttatcgaccg
acgccatatcaccccattttcccccatctctatcgctctcgccatcctttctcaccgtca
ccctctacaacgcaaaaatctgatgatcatctccctcatttcgccatgaaagtccttcgc
aagtcagaaatcgtgaggttaaagcaagtggaacacatcaactctgagcgaattatcctt
gagcgtgtacgacatccatttatcgtcgaactgcatgccacctaccaggaccagatcaat
gtgtcttacattccaggtggcgaactcttctcacaccttcgacgggccgggcgattctcc
gccgacgtcaccaggttctatctcgcgtctatcgttcttgccattgaatacctccattcg
caaaacattatctaccgtgatcttaaacccgaaaatctccttctcgatcgtcacggctac
ctccgcatcgcggattttggctttgccaaagtggtgcaagaccgtacattcactttatgt
ggtactccggaatatcttgctccggagatcgttctctcccaaggccatggcaaagctgtc
gactggtgggctcttggtatcctcggttttgaaatgcttgctggttatccccctttcttt
gatgatcatccgctcggtatctacgaaaagattctccgcggagatattgcatttccttca
catgtcgatccttatgccaaagatctcattagggggtttttgacagcggatcgaagtaag
aggttaggcaacttgaggggcggggcgaaggatgtaatgggacatccgtggtttgcgggt
gtggattggagaagcctagagaggaaggaaattggagctccgatcgtccctcgagtggct
agcatgggcgattcacagaatttccagcggtatccacctccccgaccacaagaccttcct
ggtgtatttggccaaacgtacaacacatcgaacgatccatgtggcgagctattttcagac
ttcagtttccctggaggagggagcgagagggggtctgcgagtgggtctactgaggtcttg
agtcgggattag

DBGET integrated database retrieval system