KEGG   Cryptococcus neoformans B-3501A: CNBI3200Help
Entry
CNBI3200          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CNBI3200
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     CNBI3200
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     CNBI3200
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 224 aa AA seqDB search
MTLITHAPPPPPSSEPDSPHDRSLYVYHFVFDFHIRTMKAYIYDDKPGDQRLPHDTGIDI
PEPTLAKLGVVYQRIPIDSEGAWESKIDEFAKERGYKNRDRITVTREGLGEAYEEKIKSF
FDEHLHEDEEIRYILAGSGYFDIRGAEGVHEEQWIRIALEAGDLIVLPAGIYHRFTVDSA
NTITAMRLFQDEPKWTPYSRKADGTDKLGSRDKYLETVRVGVTA
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgacactgataactcacgcgcctccacctccaccctcaagtgagcctgattcgccacac
gatcgttctttgtacgtataccatttcgttttcgatttccacataagaacaatgaaggcg
tacatttacgacgacaagcctggagaccaacgtctccctcacgataccggcatcgacatc
cccgaacccaccctcgccaagctcggcgtcgtctaccagcgtatacccatcgactctgag
ggcgcgtgggaatccaagattgacgaatttgcaaaggagcgaggatacaagaacagggac
cggattactgtgactagggaagggttgggagaggcatatgaggagaagatcaagtcgttc
tttgacgagcatttgcatgaagatgaggagattcgatacatcctcgcaggatcggggtac
tttgatatccggggtgcagaaggagtgcatgaagagcaatggattaggatcgcactcgaa
gctggtgacttgatcgtccttcctgctggtatctaccaccgttttacagtcgactctgca
aacaccataacagccatgcgactcttccaagatgaacccaaatggacaccgtactcccga
aaagcggatgggacagacaagttggggagtagggataagtaccttgagacggttagagtt
ggtgttactgcttga

DBGET integrated database retrieval system