KEGG   Cryptococcus neoformans B-3501A: CNBI3250Help
Entry
CNBI3250          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
cnb  Cryptococcus neoformans B-3501A
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 621 aa AA seqDB search
MLSAQPPIDPSPPPSSSSSRRVAYYYDQDVGNYNYYLGHPMKPHRIRMAHNLIVNYGMCD
EEGQEHGPAEVWGEGKRAVNDEIAQNWGGGEMGDAEVKWEKAALRGSRSKTMQVFKPRRA
TKEEMTRFHTDEYIDLLEAVTPETADALTGGGTRCLIGEDCPAFDGLFEFCTISAGGSLG
AAERLNAGAADIVINWAGGLHHAKKTEASGFCYVNDIVLGILELLRIHPRVLYIDVDVHH
GDGVEEAFYVTDRVMTCSFHRFGEFFPGTGDVRDVGMKKGKGYAVNVPLRDGITDDSFQS
IFKPVIDRIMSHFRPSAVVLQMGADSISGDKLGGFNLTLEGHAECARFIKSFNVPVMMVG
GGGYTVKNVARAWTKETAIMCGVDLAEDLPYNQFLEYYGPRYKLEVLPTNAVDHNPPEYL
ERIKNQVFENLRSLPFAPSAQMRSVPSKTIGQVLGITDGGDEEPEDEIDQRIKKLLKRRR
ANVLDVDASSSSESETDTPAFSRPGRARRQGGNFSGRGRSSRLAQLQRNRERREAAQEAS
NEVEDDPCGVLGKKKRSFFKVVPKLNGVGVEPIDATGFGIGVVTNGLNGVGGLKDRLGIP
VVEQWKGDGIVSRGGTPASIA
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccgcccagccaccgatagacccatccccacctccatcttcctcctcctctcgc
agggtagcatactattacgatcaggatgtgggaaactacaactactatctgggtcatccc
atgaagccccaccgaataaggatggcgcacaatttgattgtcaactacgggatgtgtgat
gaggaagggcaggagcatggccccgcagaagtatggggcgaaggaaagagggcagtgaat
gatgagattgcccaaaattgggggggaggcgagatgggcgatgcagaagtgaagtgggaa
aaggcggcgcttaggggatcaaggagtaagacgatgcaggtttttaaacctcgaagggct
accaaagaagaaatgactcggtttcatacagatgaatatatagacctgctagaggcagtt
accccggagactgcggatgctttaacagggggcggaacgaggtgccttattggtgaggac
tgtcccgcattcgacggtttattcgagttctgcaccatctctgcaggtggatcgttaggt
gctgctgaacgtctgaacgccggtgctgccgacattgtcatcaattgggctggtggtctg
catcacgccaagaagactgaagcaagtggtttctgctacgtgaatgacattgtgttgggt
attcttgagcttctcagaatacatccccgagttctctacattgatgttgacgtacatcac
ggagacggtgtagaggaagcgttctacgtaacggacagggtcatgacttgtagtttccac
cgatttggagaattctttcctggtacaggtgatgtcagagatgttggtatgaagaaagga
aaaggctacgccgtgaacgtcccactccgagacggtatcaccgatgacagtttccaatca
atattcaagcctgtgattgaccgtatcatgtcacacttccgacccagcgctgtcgtcctt
caaatgggtgccgattctatatcaggcgacaaactcggtggcttcaacctaactttggaa
ggtcatgcggagtgtgccagatttatcaagagtttcaatgtacctgttatgatggttggt
gggggtggatatactgttaaaaacgttgcaagggcttggactaaggagactgccattatg
tgcggtgtggaccttgctgaggacttgccttacaatcaattcttggaatattacggacct
cgatacaagcttgaagttttgcccaccaatgccgtagaccataatccccccgaatacctg
gagcgtatcaagaatcaagtgtttgagaacctccgaagtcttccatttgctccttctgct
caaatgcgttctgtcccaagtaagactattggccaggttttgggtataacggatggcggt
gacgaggaacccgaagatgagattgatcagcgtataaagaaactgttgaaacggcgccga
gccaatgtcctagatgtcgacgcctcttcatcttccgaatccgaaaccgacaccccagcc
ttctcccgtcccggacgagccagacgtcaaggtggcaatttttccggccgtggtcgctca
tcccgtctcgcccaactgcaacgtaaccgcgaaagaagggaagcagcgcaggaagcgtcc
aatgaagtggaagatgatccttgtggggtgttggggaagaagaagaggagtttcttcaag
gtggttcccaagttgaatggtgtgggagttgagccgatagacgcgacgggtttcggaatc
ggtgtggtgaccaatggactcaatggtgtaggaggattgaaggatcggttggggataccg
gtggtagagcagtggaaaggggacgggatcgtgtcgaggggtggtacgccagcgagtata
gcgtga

DBGET integrated database retrieval system