KEGG   Cryptococcus neoformans B-3501A: CNBJ0180Help
Entry
CNBJ0180          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    CNBJ0180
Exosome [BR:cnb04147]
 Exosomal proteins
  Proteins found in most exosomes
   CNBJ0180
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 1684 aa AA seqDB search
MAAPEKPIVFTEHLQLTALGVQPTSISFQTLTLESDAWICVRETGDTPQVVIVNLNDAGD
VVRRPITADSAIMNPRANEKILALKAGRQLQVFNLGAKAKLGTHLMNDDVTFWTWINNTT
LGIVTEREVYHWKVMDGQTAPTKVFDRHANLTANQIINYRISHDEKWLVLVGISSNPNAG
QPGENGFKIKGAMQLYSIERGVSQPIEGHAATFASIKLDGAPNPTKLFAFAVRSAAGAKL
HIVEIGHQAPNPPFQKKAVDVFFPPEALNDFPVSLQVSQKHGILYLVTKFGFIHLYEIET
GQCIYMNRISGETIFTTAEYETLSGIIGVNRKGQVLSVSVDEQTIVPYIQQTLNNPELAI
KLATRAGLPGADGMIQQQYQVYIQNGQYGEAAKIAANSPRGLLRTPQTIETLKNLPAVPG
TLTPILQYFGILLEKGELNKYESLELARPVVQQGKKQLLEKWLKENKLESSEELGDLCRM
ADMNLALSVYLRANVPNKVVACFAELGQFDKIVLYSKKVGYTPDYAQLLQHLVRINPDKG
AEFATQLVNDENGPLVDLDRIVDIFMSQNMLQQATSILLDALKDNKPEQGPLQTRLLEMN
LMSAPQVADAILGNEMFTHYDRPRIANLAEKAGLVQRALEHYEDINDIKRVVVHTNLFKP
EWLVDYFGRLTVEQSFACLQEMLRTNLRQNLPIVVQIATKYSDLLGSVKLIELFEQFKSS
DGLYYYLGSIVNLSEDPEVHFKYIQAATRTGQIREVERICRESNFYNPEKVKNFLKEARL
DDQLPLIIVCDRFDFVHDLVLYLYQNGLTNFIEIYVQRVNSARTPQVIGGLLDVDCDETT
VKNLLMSVTGTFPIDDLVDEVEKRNRLKLILPWLNNKVEQGSTDHAIYNAIAKISIDSNN
NPEKFLKENNLYDPAIVGKYCEKRDPYLAYIAYAKGFCDDELINITNENQMYKHQARYLV
KRRDVDLWTQVLNPESIHRRALIDQIIATAIPECVDPDDVSVTVKAFMHMELHGPLLELL
EKIIIEPSPFSDNRSLQSLMFLTAIKNDKGKVMGYINKLSGYDVETIAKVATEAGLYEEA
FTIYQKHDMHAEAMSVLVEHMASIDRGFAYANKINEPAVWSRLGKAQLDGLRVKEAIDSY
IKADDPSNFEEVIEIANRAGKHDDLVRYLQMARKTAREPKIDTELAYAYAKTDRLHDMEE
FLGMTNVADVLQVGEKCFDDELYQAAKLLFSSISNWARLATTLIYLGENQAAVDAARKAG
NTQVWKQVNAACVDKKEFRLAQICGLNLVVHAEELPALLSLYERNGYFDEIISLMEAGLG
LERAHMGMFTELSVLYAKYRPEKLMEHLKLFWQRVNIPKVIKAAEQAHLWPELVFLYIVY
DEPDNASLAMMERLADWDHDQFKKVIVKVANMEIAYRAVSFYLARQPTLLPDLLAALTPR
LDHSRVIKILQTEDHLPLAKPYLIATQKLNLAVINEAYNDLLIEEEDHVTLRSSLETYDE
YDAIKLAKRLEKHELLEFRRIAALLYRLNSLWEESISLSKADRLWRDALETAAASKDIAV
CEELAGYFVSIGNKDAFAAILYVCFEFVRADFVEEMSWRFGLSDYSMPYKLQQQRDQATK
VAALEKEVKELRTKTAEKEPDNEPSNLMGSGLGGRLMIGGPSGGPPFMGNMPNGGMMAQP
TGFY
NT seq 5055 nt NT seq  +upstreamnt  +downstreamnt
atggcagcgccagagaagcctatcgtgttcactgaacacctccaactcacagccctaggc
gtccaacccacctccatctccttccaaacactaacactcgaatcagatgcctggatttgt
gtcagagaaaccggcgatacacctcaggtcgtcattgtcaacttgaacgatgctggtgat
gtcgttaggaggcctatcacggctgattcggctattatgaacccaagagcaaacgagaag
atcttagctctcaaggccggtcgacagctccaagtgttcaacctcggcgccaaagccaag
cttggtacccaccttatgaacgacgatgtgactttctggacttggatcaacaatactact
ttgggtatcgttaccgaacgagaagtgtaccactggaaggttatggatggtcagactgct
cctaccaaggtatttgaccgacacgccaacctcactgcgaaccaaatcatcaactataga
atatcacacgacgaaaaatggcttgttcttgtcggtatctcttctaatcccaatgccggc
caacccggtgagaacggtttcaagatcaagggtgccatgcaactctactctatcgagaga
ggcgtttcacaacccatcgaaggtcacgccgctacattcgcttccatcaagctcgacggt
gctcccaaccctacaaaactgtttgcctttgcagtcaggtctgctgctggtgccaaattg
cacatcgttgagattggtcaccaggcacccaaccctcccttccagaagaaggctgtcgac
gtgttcttccctcccgaggccctgaacgactttcccgtctctttgcaagtctcccagaag
catggtattctctacctcgtcaccaagttcggtttcattcacctttatgaaattgaaact
ggtcagtgtatctacatgaacaggatttccggcgagaccattttcaccaccgccgagtat
gagacattgtcaggtatcatcggagttaacaggaagggccaagttttgagtgttagcgtg
gatgagcagactattgtgccctacatccaacaaactctcaacaacccggagctcgctatc
aagcttgctactcgtgccggtctccctggggcggacggtatgatccaacagcagtatcaa
gtttacatccagaacggccagtacggcgaggctgccaagattgccgccaactctccccgt
gggttgttgcgaacccctcaaacaattgagacgctcaagaatctccccgctgttcctggt
actcttactcccatcttacagtactttggtattttgctcgagaagggagagctcaacaag
tacgaatctcttgaacttgcccgccctgttgtccagcaaggcaagaagcagctcctcgag
aagtggctcaaggagaacaagctcgagagcagtgaggagctcggtgacctctgtcgaatg
gccgatatgaacctcgctctatccgtctaccttcgtgccaacgttcctaacaaggtcgtt
gcttgtttcgctgagctcgggcaatttgacaagattgttctctactccaaaaaagtcggc
tatactcctgactatgctcagcttcttcagcatcttgtgcgtatcaaccccgacaaaggt
gccgagtttgctacacagctcgtcaacgatgagaacggccctctcgttgaccttgaccga
attgtcgacatcttcatgtctcagaacatgctccagcaagctacttctattctcctcgac
gctctcaaggacaacaagcccgagcaaggtccactccagacaaggttgcttgaaatgaac
ttgatgagcgctcctcaggttgcggatgccattttgggcaacgaaatgttcacccactat
gacaggcctcggatcgccaacctcgctgagaaagcgggtcttgtgcagagggctttggag
cattacgaggatatcaacgatatcaagagggttgttgtacacaccaacttgttcaagccc
gagtggctggtggactactttggacgactcactgtcgagcagagctttgcttgtttgcaa
gaaatgttgaggacgaacttgaggcaaaatttgccgatcgtcgtgcagatcgctaccaag
tactctgacttgcttggttctgtcaagctcatcgaactgtttgagcagttcaagagttcg
gacggtttgtactactatctcggttccattgtcaacctcagcgaagaccccgaggttcac
ttcaagtacattcaagctgctacccgtaccggccaaatccgcgaggtcgagcgtatctgc
cgagagtccaacttttacaaccccgagaaggtcaagaacttcctcaaggaagcccgtctc
gacgaccagctccctcttatcattgtctgcgaccgatttgactttgtacatgacttggtt
ctctacctttaccagaacggtttgaccaatttcattgagatttatgtccagcgagtcaac
tctgccagaaccccccaggttatcggcggattgttggatgttgactgcgatgagacaacc
gtgaagaacttgttgatgagtgttaccggcaccttccccattgacgatttggtggatgaa
gtcgagaagcgaaacaggctcaagctcatcttgccttggctcaacaacaaggttgagcag
ggttctaccgaccacgcgatttacaacgccatcgccaaaatctctatcgactcaaacaac
aaccccgaaaaattcctcaaggagaacaacctttacgaccccgctattgtcggcaagtac
tgcgagaagcgagatccttatctcgcctatattgcttatgccaagggcttctgtgacgac
gagctcatcaatatcaccaacgagaaccagatgtacaaacatcaggctcgatacctcgtt
aagcgacgcgacgttgacctctggacacaagtcctcaatcccgagtctatccaccgccgt
gcccttatcgaccagatcattgccactgccatccccgagtgtgtcgatcctgatgatgtg
tccgtcaccgttaaggcattcatgcacatggaacttcacggtcccttacttgaattgctc
gaaaagatcataattgagccatcacctttcagcgacaaccgctctttgcagagcttgatg
ttcctcaccgctatcaagaacgacaaaggcaaagttatgggttatatcaacaagctttca
ggatatgacgttgagactatcgccaaggtcgctaccgaggccggtctttacgaggaggcg
ttcacaatttatcagaagcacgacatgcacgccgaggcaatgagcgtccttgttgaacat
atggcttccattgaccgaggcttcgcctatgccaacaagatcaacgagcccgctgtctgg
agcagactcggtaaagcccaacttgacggtttgcgtgtcaaggaggctatcgactcttac
atcaaagctgatgacccatccaactttgaggaagttattgagattgccaaccgagctggc
aagcatgacgacctggtgcgatacctccagatggctaggaagactgcccgcgagcccaag
attgacactgagctcgcttacgcttacgccaagactgaccgattgcacgatatggaagag
ttcctcggtatgaccaacgttgccgacgtcttgcaggttggtgagaaatgtttcgatgat
gagctttaccaggctgccaagctcttattctcaagcatctccaactgggctaggttggca
accactttgatctacttgggcgagaaccaggcggcggttgacgcagctaggaaggctggt
aacactcaggtgtggaagcaggttaacgctgcttgtgtggataagaaggagttccgattg
gcgcagatttgtggtttgaaccttgtcgttcacgccgaggaacttcctgctttgttgtca
ctttacgagaggaatggctactttgacgagattatctccttgatggaggccggtttgggt
ttggagagggctcacatgggcatgttcacagaactgagtgtcttgtacgccaagtaccga
cccgagaagctcatggagcacttgaagctcttctggcagcgtgtcaacattcccaaagtc
atcaaggccgcagaacaggctcacctctggcccgagcttgtcttcctctacattgtctac
gatgaacccgacaacgcttctttggctatgatggagcgactcgccgactgggaccacgat
caattcaagaaggttattgtgaaggttgccaatatggaaattgcctaccgggccgtgtcc
ttctaccttgctcgacaacccaccctcctccccgatcttcttgctgctcttaccccccga
cttgaccacagtcgagttatcaagatcctccaaaccgaagaccacctccctctcgccaaa
ccttacctcatcgccacccaaaagctcaatctcgccgtcatcaacgaggcttacaacgac
ctgcttattgaagaggaggatcatgtcactttgcgaagcagtttggagacttatgatgag
tacgatgcaattaagttggcgaagagattggagaagcacgagttgttggagtttaggaga
atcgctgctttgctttaccgactcaactctttgtgggaagagtctatttctctctcaaag
gccgatagattatggcgagacgcccttgagactgctgctgcgagcaaagacattgccgtt
tgtgaggagcttgcaggctactttgtttctattggcaacaaggatgctttcgctgctatt
ctctatgtctgcttcgagtttgtccgagctgactttgttgaggaaatgtcttggcgattc
ggcttgtcagattactctatgccttacaaactccagcaacaacgagatcaagctaccaag
gttgcggcgcttgaaaaggaggtcaaagagcttagaactaagaccgctgagaaggaaccg
gataatgagccaagtaatttgatggggtctggattgggtgggagattgatgattggcgga
ccttcgggcggaccacccttcatgggtaacatgccgaatggaggtatgatggctcaaccc
actgggttctactaa

DBGET integrated database retrieval system