KEGG   Cryptococcus neoformans B-3501A: CNBJ0440Help
Entry
CNBJ0440          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cnb00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 1593 aa AA seqDB search
MTILDSLKPSNIEIPKPKAVLQGDGKKTPKTPQDEAISFFSREGDGEPVQVWELSLEDDG
GPSPEKSYIRLPPPFKPYVLRFTLQPGTDVTRNGVLKSDFPMDGGAFKRDDWKERKLPSN
LSKPIEVDLPISAPGAFCYFIEYDSPDSTGRVQGRKGYFNVDPIITLPARTPFFPPDTPI
TSGPLKDESSGAILPKDKQLSLDGLIIISVLAKWMGKTTEWEPFFAEASRRGYNMLHWAP
LQQKGMSGSPYSIQNQLVFDIDLLKDSKAKDGGVKEVEEVLKFAKEKYGLGGVTDVVLNH
TAYDSPWLQEHPEAGYSPYNTPHLAPALEFEDALLGLTSRLSSVGLPTNLKSESDLQALI
PHIKSSIDDAKLWEYYIFDVQGSERAVADSLLNSKPEAPKPWEGSSLQGKSLNELAEIVK
SSDIITSYRAYSSRYCTSVPPAVAAGFIQAAYPGDSAENQASRWGKILDVLNVDLYKECN
EDIQAGIDGVVGRLRYTRLEEGGPKLGELTEERAILERYFTRIPKNDITKKHPENALAVA
NNGWMWAADPLNNFAEYPSKAYLRRQVIVWDDCVKLRYGSQASDNPWLWQHMISYAELLA
GMFDGFRLDNCHSTPLPLGKAIIDAGRRVNPNLYVMAELFTGSQEMDLKFVRELGINSLV
REAYNGNTVKNFADLLWRFGLGKPVGSMDVACLTSSGEVHLSLSSSKSSTRPALVTPLQG
SVPHAVFYDLTHDNQSPRDKRTAEDALSTGALVTFCAAALGSNKGFDDLYPKLLDLVTDN
RKYEVISKEKEKSSGIGNVKRVLNALHVEMMEGGYSEGYVHEDGEYLMIHRIHPVTHKGY
MLVAHTAYPGFKGRGWVKPIRLGRTSISYIFGASIKTRFEEWEDDPSTHRGIPSTLTEIG
PPEITKGIENGEEYQEVVVPEDFAPGSIMVFATQMSDISGDLDAFCKEGAIDAMSQLDLV
DLNVILHRADGEEQDATGGDGTYTIPNYGAITFCGLEGWMHPLREITKKNDLGHPLCQHL
REGTWAFDYVVNRLNKQTFDLPRLEAPAKWFASRFDQIKATAPSFMRPKYFSLVIHEAYK
AARRAVVEQCSEFVSSGHSLTHNLALCSVQMYGLVKSASLDPGRAVPSLAAGLPHFAAGW
ARCWGRDVFISLRGLFLTTGNYPAARAHILSFGSTLKHGLIPNLLDSTRNPRYNCRDGPW
WFIQNIQDYTHMAPNGLTILSDKVKRRFPADDTWVAWDSPRAYEYESSVAELIQEILQRH
AEGIEFREYNAGPNLDMDMRDEGFNQKIWVDWETGIIFGGNRYNCGTWMDKMGSSEKAGN
KGLPATPRDGAPIEITGLLKSALTWLDKLSKGGKFPFKGVNASVKGKKRLVTYKEWSDLI
QASFEKHYYVPSDPAEDDKYVINKGLVNRRGIYKDVFGTPKDREWSDYQLRCNFTLPMVV
APELFTPSKAIGALSIADAVLRAPLGMKTLDPSDSQYRGDYDNSNDGTDQAIAKGWNYHQ
GPEWGFPLGWFLMAYLKFDRLAGEGKSNPTKTMHYISNILRNLARHIESDPWRGLPELTN
SNGSFCYDSCNTQAWSASTILDVLEEMHKIGKN
NT seq 4782 nt NT seq  +upstreamnt  +downstreamnt
atgactatcctcgactccctcaaaccaagcaacatcgagatccccaagcccaaggctgtc
cttcagggcgatggcaagaagactcccaagacaccgcaagatgaagccatttcattcttc
tcgagagaaggagatggtgagccagtgcaggtctgggaactgtcgttggaggatgacgga
ggccctagtccagaaaagagttacattcgacttccgcctcccttcaagccgtacgtcttg
aggtttactcttcagcccggtacggatgtcactcgcaatggcgtgcttaaaagcgacttt
ccgatggacgggggcgcgtttaagcgggatgactggaaagagcgaaagttgccctccaac
ctgagcaaacctatcgaggtcgaccttccgatttccgctcccggagcattctgctacttt
atcgagtatgactcgcccgattccaccggtcgagttcaaggccgaaaaggctactttaac
gttgatcccatcatcactcttcctgctcgtaccccattcttccctcccgatacccccatc
acatctggccctctgaaagatgagtcttcaggtgccatccttcccaaggacaagcagctc
agtcttgatggtcttatcatcatctctgttcttgctaaatggatgggcaaaactacagaa
tgggaaccattcttcgcggaagctagcagaagaggctacaatatgcttcattgggcgcct
cttcaacaaaaaggcatgtctggcagtccctactctattcaaaaccaactggtctttgat
atagaccttttgaaggactccaaggcgaaggatggtggggtaaaggaggttgaagaagtg
ttgaagtttgcaaaggaaaagtacggattggggggtgtcactgacgtggtgttaaatcac
actgcgtatgactcgccttggttgcaggagcaccctgaagctggttattcaccatacaac
actcctcatctcgcccctgctctcgaatttgaggatgctctgcttggcttgacatcaagg
ctctcgtccgttggtctccccaccaacctcaaatccgaatccgacctccaggcgttaatc
ccccacatcaaatcttccatcgacgacgccaaattgtgggagtactacatctttgacgtc
caaggttctgagcgtgctgttgccgattctttgctcaattccaagcctgaagcgcccaag
ccttgggagggatcttcccttcaaggcaagtcactcaatgaactcgccgaaattgtcaag
tcttccgatatcatcacttcttatcgcgcttactcctctcggtactgcacctctgtccct
cccgctgtggctgcaggatttattcaagctgcttacccaggtgattcggcagagaaccaa
gccagtcgatggggcaagatcttggatgtgctgaatgtggacctttataaggaatgtaat
gaggatatccaggctggtatcgatggtgttgtggggaggttgagatatactagattggag
gagggtggacctaagcttggagagcttaccgaagagcgggcgatcctggagcgctacttc
actcgaatccccaagaacgacattaccaagaaacaccccgagaatgccctcgctgtcgcc
aacaacgggtggatgtgggctgctgatcctctaaacaactttgccgaatacccttctaaa
gcctacctccgccgtcaggtcattgtctgggatgattgtgtcaagctccgatacggttct
caagcttctgacaacccgtggctatggcagcacatgatctcctacgccgaacttctcgct
gggatgtttgatggtttccgtttggacaattgtcactctaccccgttgcccttgggcaag
gccatcatcgacgctggtcgacgagtgaacccgaatctctacgtcatggctgaactcttt
actggaagccaggagatggacttgaagtttgtcagggagttgggtatcaacagtctcgtc
agggaggcttacaacggcaacactgtcaagaactttgcggatctcctctggagatttggt
cttgggaagcctgtgggttctatggacgttgcatgccttacatcatcaggagaagtccac
cttagcctttcatcgtcaaagtccagcacccgtccggcgcttgtcacccctcttcaaggc
tctgtgccccacgcagtcttctatgaccttacccacgacaaccagtcccctcgagacaag
cgaactgctgaagatgccttgtctacaggtgctcttgtgaccttttgtgctgccgctttg
ggatccaacaaaggttttgatgacctctaccccaagctacttgatctggtcaccgataac
agaaagtatgaagtcattagtaaggagaaggagaagtctagcggtatcggtaatgtcaag
cgagtgttgaacgcccttcatgtggagatgatggagggtggttactctgaaggctacgtg
catgaggacggcgagtacctcatgattcaccgaattcaccccgtcacccacaagggatac
atgcttgttgctcatacggcttacccgggcttcaaaggtcgaggatgggtcaaacccatt
agactcggtcgaacctctatctcatatatcttcggtgcctctatcaagacccgctttgaa
gaatgggaggacgacccctctactcatcgtggcatcccgtcgacccttacagagattggc
ccccctgagattaccaaaggcattgagaatggagaggagtatcaagaggttgttgtgcca
gaagatttcgctcccggaagcatcatggtctttgctactcagatgagcgatatttctggt
gatctggatgcgttctgcaaagaaggtgctatagatgctatgagccaactggacttggtg
gacctcaacgtcatcctccacagggctgacggtgaagagcaggatgctaccggtggtgat
ggtacttacactatccccaactacggcgccattactttctgcggtcttgaaggctggatg
caccccttgcgagagatcactaagaagaacgatctcggtcatcctctctgtcaacacttg
cgagaaggtacttgggcttttgactatgttgtaaacaggttaaacaagcaaacctttgat
ctccctcgccttgaggctcctgccaagtggttcgcttcccgcttcgatcagatcaaggct
accgccccttctttcatgcgcccaaagtacttctccctcgtcatccacgaagcttacaag
gcagctcgccgagctgttgttgagcaatgctctgagtttgtttcttctggccattcgctc
actcacaatcttgccttgtgctctgtgcaaatgtatggcttggtgaagagtgccagcttg
gatcccggaagagctgtgccaagtctggcagccggcttgccccatttcgccgctggttgg
gctagatgttggggacgagacgtcttcatctctcttcgaggtcttttccttactactggt
aactatccagctgctagggcccatatattatccttcggcagcactctcaaacacggcttg
atccccaacttgctcgactcaacgcgaaatcccaggtataactgtcgcgatggcccttgg
tggttcattcaaaatatccaggattacacccatatggctcccaacggtttgaccatcctc
tctgacaaagtcaagcgccgattccctgcggatgacacctgggttgcttgggatagcccc
agagcgtacgagtatgaaagcagcgtcgctgaattgatccaagagatcttgcagaggcat
gcagagggtattgaattcagggagtacaatgctgggcccaaccttgatatggacatgcgc
gacgaagggttcaaccagaagatttgggttgattgggagactggaatcatctttggtggc
aacagatacaactgtggtacctggatggacaagatgggttcgtctgaaaaggcaggtaac
aagggccttcctgctaccccccgggatggtgctcccattgagatcaccggtctactcaag
agtgcccttacttggcttgataagttgagcaaaggtggcaaatttccttttaagggcgtg
aatgcttctgtcaagggcaaaaagcgtctcgtgacgtacaaagaatggtctgacctcatt
caagcctcttttgagaagcattactacgttcccagcgaccccgctgaagacgataaatac
gttatcaacaagggtttggtcaaccgccggggtatctacaaggatgtatttggaactcca
aaggatagggagtggagtgactaccagcttcgatgcaacttcacgcttccgatggttgtc
gctcctgagcttttcactccttccaaagccattggcgctttgagtattgccgatgctgtg
cttcgcgctcctcttggtatgaagacccttgacccttctgacagccaatatcgaggcgac
tatgacaactcgaacgatggtacagatcaagccattgccaagggctggaactatcaccag
ggccctgagtggggcttccctcttggttggttcctcatggcttacctcaagttcgaccgt
ctcgctggtgaaggcaaatctaatcccaccaagactatgcattacatctccaatatcctt
aggaatctcgcccgccacattgaaagtgacccatggcgaggcttgccggagctaaccaat
agcaatggaagcttctgctatgactcctgtaacactcaggcatggagcgcaagtacgatt
ctcgatgtattggaggaaatgcacaagattgggaagaattag

DBGET integrated database retrieval system