KEGG   Cryptococcus neoformans B-3501A: CNBJ1530Help
Entry
CNBJ1530          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CNBJ1530
   00670 One carbon pool by folate
    CNBJ1530
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     CNBJ1530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 258 aa AA seqDB search
MFPPGTTCKSNSTPSQHRCMRPLLNALRTMQTTAKSSTPSITAVVAATAENGIGLNGGLP
WRLPGEMKYFARVTTGETPSSDPSEQNVVIMGRKTWESIPSRFRPLKNRRNVVISGKGVD
LGTAENSTVYTDIPSALSALRSTTESGHSPRIFLIGGATLYTSSLLPSSVPSLNSSTSTS
PLPFSRPLIDRILLTRILSPFECDAYLEDFAAHTKPDGSKVWKKASIKEFREWIGWDIEE
QVEEKGVKYIFEMWVLNQ
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttcccccccggcacgacttgcaaatccaactcgactccatcccagcaccggtgtatg
cggccgctcctcaacgccctccgcacgatgcagaccacagccaagtcgtccaccccgagc
ataacagccgtcgtcgcagccacggccgagaatggcatcggtctcaacggtggcttgcca
tggagattaccaggcgaaatgaagtactttgctcgagtcaccaccggcgagacaccttca
tcagatcccagcgaacagaatgtagtcatcatgggccgcaagacatgggaatccatccct
tccaggttcagacctttgaaaaaccgccggaacgtggtcatctcaggtaaaggcgtggac
ctgggaacggcggaaaattctactgtctacactgacataccctctgccctctccgccttg
cgttctaccacggaaagcggccattcaccccgtatattcctcatcggcggcgcaaccctc
tacaccagctctctcctcccgtccagcgttccctctctcaactcgtcaacctccacatct
cctcttcctttttcccggcccctgatcgaccgtattctcctcactcgaatcctttcccct
tttgaatgcgacgcgtatcttgaagactttgcggcacacacaaaacctgatgggagcaaa
gtttggaaaaaggcttccatcaaagaatttagagaatggattggatgggatatcgaagaa
caagttgaagaaaagggggtcaagtacatattcgagatgtgggtgttgaatcaatag

DBGET integrated database retrieval system