KEGG   Cryptococcus neoformans B-3501A: CNBJ1540Help
Entry
CNBJ1540          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:cnb00514]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 807 aa AA seqDB search
MHRGIPSPPATRRHTAIQHTPWENRVPPSAYGSARPHSAFLEATPHDDAELPLFKDTNME
LKRRFDEKQPVHLEQPVVDDDQGKWEKGYGAGPGIGGRRGLPPRQRIPGWKGIVQEHEEW
VWAGVYTLLSMITRFWRIGAANYVVWDEAHFGKFGTHYIKRDFYFDVHPPLGKMLVGLAG
LLSGYQGNFEFKSGVAYPEDVPYTAMRVMLASFGVALVPLAWFTSGELGWSRWTRHWVTI
CVLCDIGWLCISRFILLDSMLLFFTFTTTLGLVKFRNQRHAPFSDDWWIWLVFTGWSIGC
VCSVKWVGMFITALVGLYTIEDLWEKFGDLSMPIRTYITHWVARITCLIILPFIVYASCF
KIHFLILNRSGPGDAQMSSLFQAHLRGNDFAESPLEIAYGSTVTLKNYGYGGGLLHSHVQ
TLPVGSLQQQVTCYHYKDENNNWQIVPPWGADPVDPDGPIRFLKDGDEIRLVHTQTGRNM
HSHAIAAPVTKESWEVSGYGNLTIGDENDLWIVEVVDDTHTSKKNNEDGRIHSLTTRMRL
KHRQLNCYLRAANAVLPQWGFKQVEVSCTKENNPKDLHTYWNVESHWNDRLPAGNAKLYK
SPFWRDFVHLNVAMWTSNNALVPDPDKEDILASQPFDWPFLHLGLRMCGWGDHQIKFYLL
GTPIIWWFSTISLAIGLGLAAWYVARMQRGYKEWKAGEWDHWLWAGKVAFGGWALHFFPF
LIMGRVTYLHHYLPTLYFAVLMAGHILDHFFFASSTRSHTKKLIWFAVWAGVVILSFWWF
KDLALGISGNVNNHWGWGWRSSWNIYN
NT seq 2424 nt NT seq  +upstreamnt  +downstreamnt
atgcacaggggcataccatccccgccagcaacacgcagacacacagccatacaacacact
ccctgggagaacagagtacctccctccgcctacggctcagcacgcccacacagcgctttc
ctcgaggcaacgccccacgacgacgcagagctcccgctcttcaaggacaccaatatggag
ctcaagagacgtttcgatgaaaaacaaccggtgcatctagagcagcctgtcgtggacgac
gaccagggcaagtgggaaaaggggtacggcgcgggaccaggaatcggcgggcgaagaggt
ctgccgcctagacagagaataccgggatggaagggtatcgtgcaggaacacgaagaatgg
gtatgggcaggggtctacactttgctgagtatgattacgcgattctggcgcatcggtgcc
gccaactacgtcgtctgggacgaggctcatttcggcaagtttggaacacactacatcaaa
cgtgatttctactttgatgtccacccgccgctcggcaagatgctggtcggtcttgcaggt
ttgctctcaggctaccagggcaactttgaattcaagtcgggtgttgcgtacccggaagat
gtgccgtacacggcgatgagagtcatgttggccagctttggtgtggctctcgtgccgctt
gcttggtttacttctggagaattgggatggagcaggtggacaaggcattgggtgaccatt
tgtgtcctgtgtgacatcggatggctttgtatttcccgatttattctcctcgactccatg
cttttgttcttcacctttacgacgactcttggtcttgtcaagttccgcaaccaacgacat
gccccatttagcgacgactggtggatctggcttgtcttcacgggatggtcgatcggttgt
gtgtgtagtgtcaagtgggtgggaatgtttatcaccgcgcttgtcggcctttacacgatt
gaagatttgtgggaaaagtttggtgacctttccatgcccattcgcacgtacatcacccac
tgggttgcccgaatcacctgccttataatccttccctttatcgtctacgcttcgtgcttc
aaaatacacttcctcatcctcaaccgatcgggccccggtgatgcccaaatgtcttccctc
ttccaagcccatttgcgtggtaacgactttgccgagtctcctctcgaaatcgcctacggc
agtaccgtcaccttgaaaaactatggctatggcggtggtttactgcattcgcacgtgcag
actttgcccgtgggaagtctccagcaacaggtcacgtgttatcactacaaggacgagaat
aacaactggcagatcgtacctccttggggcgctgatcctgttgatccagacggaccgatt
aggttcctgaaggacggcgatgagatccgactcgtgcatacccaaactggacggaacatg
cactctcacgctatcgctgcgccagtcaccaaggagagctgggaagtctctgggtatggt
aatcttaccattggcgacgagaatgatctttggattgtcgaggtcgtcgatgatacccac
acatccaagaagaataacgaagacggtcgtatccactcgttgaccacacgaatgaggctc
aagcaccgccaactgaattgttacctccgcgccgccaacgccgtcctgcctcagtggggt
ttcaagcaggtagaagtttcctgtacaaaagaaaacaatcccaaggatttacacacgtac
tggaacgtcgaatctcactggaacgatcgattgcccgctgggaacgccaagctgtacaaa
tctcccttctggcgcgactttgtccacctcaacgttgccatgtggacatccaacaatgct
ctcgtcccggacccggacaaggaagacattctcgcttcacaaccattcgactggccattc
ctccatcttggtcttcgtatgtgtggctggggcgatcaccaaatcaaattttacctcctc
ggcacacccatcatctggtggttctcaactatcagcttggctattggtttaggtctggct
gcttggtatgtggcgaggatgcagagggggtacaaggagtggaaagcgggagagtgggat
cattggctttgggcgggtaaggtggcgtttggtggctgggctttgcatttcttccccttt
ttgattatgggtcgagttacctatcttcaccattatcttcctacattatactttgctgtt
ctcatggccgggcacatcctcgaccacttctttttcgcttcctccacccgctcacacact
aaaaagctcatttggtttgccgtctgggcaggagtggtgatactgagcttctggtggttc
aaggacctcgcgcttggtatctctggtaacgtgaacaatcactggggatggggatggagg
tcatcttggaatatctacaactga

DBGET integrated database retrieval system