KEGG   Cryptococcus neoformans B-3501A: CNBJ2280Help
Entry
CNBJ2280          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    CNBJ2280
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    CNBJ2280
Enzymes [BR:cnb01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     CNBJ2280
Lipid biosynthesis proteins [BR:cnb01004]
 Desaturase
  First
   CNBJ2280
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 594 aa AA seqDB search
MSAAVPPMTPPLEKEESELVHRRPSPVDQLDPAFTPPHTPEQNPCKSTKGKGIDPIDPTL
LASDRHIPDNYVSYTIANQKYLPPITWKNLIYNIQWISFLALTVTPSLAIYGVFTTAWNT
KTAIWSVIYYFITGLGITAGYHRLWAHRAYNASVPLQFALAIAGTGAVEGSIKWWCRGHR
AHHRYTDTELDPYSAEKGFFWSHVGWMLVKPRGKIGVADVSDLSRNRVVKWQHRHYIPLI
LGMGFVLPTVVAGLGWGDWRGGFFFAGAARLCFVHHSTFCVNSLAHWLGEQPFDNKHSPR
DHIITALCTIGEGYHNFHHQFPQDFRNAIKWFQYDPTKWFIWTMSQLGLASHLKRFPDNE
VKKGQYTMKLRLLKEQADQLEWPKSSNDLPVISWDDFKAEAKERSLVAIHGFIHDCSSFV
EDHPGGAHLIKRAIGTDATTAFFGGVYDHSNAAHNLLAMMRVGILDGGMEVEHLKRRPAE
SAASSVTNSPVSSASASSVDIQSLADDDFRLDQTQLNSQGPKPKAPFGQPQAQVADRWTL
SVPPSEKLRIVQTVPEIRPGLLTHRSTGKLNKVTKADVGGEINEFIGEKPVAAA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgccgttccgcccatgacccctcctctcgagaaggaagagagtgagcttgtt
cacaggcgaccctctcctgttgatcaactcgatcctgccttcacaccgcctcatactccc
gaacagaacccttgcaaatcaaccaagggcaagggaatcgaccccatcgaccccactctc
ctcgcttctgaccgacatattcccgataactacgtctcctacactatcgccaaccaaaaa
taccttcctcctattacatggaaaaacttgatctacaacatccagtggatctccttcctc
gcactcaccgtcactccttctctcgctatatatggagtgtttaccaccgcctggaatact
aagactgctatttggagtgttatctactatttcatcactggtctcggtattaccgctggt
taccaccgtctttgggctcaccgtgcctacaatgccagtgttcctcttcaattcgctctc
gccattgccggtaccggtgctgttgaaggttccatcaagtggtggtgccgaggtcaccga
gcccaccaccgttacaccgacaccgagcttgacccttactccgctgagaagggcttcttc
tggtctcacgttggatggatgttggtcaagccccgaggcaagatcggtgtcgccgatgtc
agtgatttgagcaggaacagggtcgtaaaatggcaacacaggcattacattcccttgatc
ttgggtatgggtttcgttctccctactgttgtcgctggtcttggctggggagactggagg
ggtggtttcttctttgctggtgcggccaggttgtgctttgtccaccactctactttctgt
gtcaactctcttgcccattggcttggtgagcagcccttcgacaacaagcactctcctcga
gaccatatcatcactgctctttgcaccattggcgagggctaccacaacttccaccatcaa
ttccctcaggacttccgaaacgctatcaagtggttccagtatgaccccactaagtggttc
atctggaccatgtctcagctcggtcttgcctctcacttgaagcgtttccctgacaacgag
gttaagaagggtcagtacaccatgaaattgcggcttctcaaggagcaggccgaccagctt
gaatggcccaagtctagcaacgaccttcctgttatcagttgggacgatttcaaggctgaa
gccaaggaacgctctcttgttgctatccacggtttcattcacgactgttcttctttcgtt
gaggaccaccctggtggtgcccacctcatcaagcgtgctatcggtactgacgccactact
gccttcttcggtggtgtctatgaccattccaacgctgctcacaacttgctcgctatgatg
cgtgtcggtatccttgatggtggtatggaggttgaacatctcaagcgacgtcccgccgag
tctgcggcttcctctgtcaccaactctcctgtctcttccgcctctgcctcctctgtcgac
atccagtctctcgccgatgacgacttccgtctcgaccagactcaactcaattctcagggc
cccaagcctaaggctcctttcggtcagcctcaggctcaggttgctgacaggtggacgctt
tctgtgccccctagtgagaagttgaggatcgtccagactgtacccgaaatcagaccggga
ttgttgactcaccgatcgaccggaaagctcaacaaggtcaccaaggctgatgtcggcggt
gagattaacgagttcatcggggagaagcctgtggctgcggcttag

DBGET integrated database retrieval system