KEGG   Cryptococcus neoformans B-3501A: CNBJ2390Help
Entry
CNBJ2390          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CNBJ2390
   01230 Biosynthesis of amino acids
    CNBJ2390
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNBJ2390
   00030 Pentose phosphate pathway
    CNBJ2390
   00051 Fructose and mannose metabolism
    CNBJ2390
   00052 Galactose metabolism
    CNBJ2390
  Energy metabolism
   00680 Methane metabolism
    CNBJ2390
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    CNBJ2390
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CNBJ2390
Protein phosphatases and associated proteins [BR:cnb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CNBJ2390
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 914 aa AA seqDB search
MSDSPAATPLPKDPEGITEQIQSVSTPPPPPQAQKPARQKKIAVLTSGGDSAGMNAAVRA
IVRQSIARGCQAYIIREGWEGLVRGNTSGPTPAPTAPQSPTLSASSKTVTFSSLPPSQQF
DKLTSTLNKESLANEVSFSDPNEVTPLEDTPLSFGYGQLLRDGAGEGDVEELASHGMQGL
AIADREDEKGRSLKNKYIVRVGWDDVRGWQGEGGTLIGSSRCPAFRTREGRLQAASNLIH
SGIDCLAVCGGDGSLTGADKLRGEWPSLVEELYTENKITDDQREAYHHLNIVGLVGSIDN
DMALTDLTIGALTALHRICESIDSISSTASSHSRAFVIEVMGRHCGWLALLAGIATGADF
IFIPEDPPKCEDWETEMCDLLQAHRKVGKRKSIVIVAEGALDRNLKPIKPDYVKKILVER
LGLDTRVTTLGHTQRGGKPCAFDRILPTLQGVEAVQTLLSATPETPSYMIGIQENKITKI
PLLEAVARTQMVAEAIENRDFAKAMSFRDSEFREMLQAFQISSSLDVSQNAPVDKRLRIG
IIHVGAPAGGMNAATRQAVRFCHNRGHVPVAIYNGFEGLLDDNVSELSWLRVDSWTTRGG
SELGTNRSLPSIDIGSVAAGFQRYSLDALLVIGGFEAFHSVVLLSQNRTNYPAFQIPIVH
LPATLSNNVPLTDFSLGSDTSLNALVEACDAIKQSASASRNRVFVVETQGGMSGYIATMG
ALAVGAVLVYTPENGISLKLLQEDVEFLIKRYKLDEKGKSEGRLVIKAEKSSSVYTTETL
TKIFKEEGKDLFDARSASLGHTLQGGVPSPLDRTRAARLSLRCMQFLEEHASPNSQASHH
KPKSAAHPHAGAKSIAKDTAAMIAIIGSKVVYATMDDVLKVTDMKLRRGTDEWWSDCKEL
AETMGGRTGLMAKH
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcgccggccgccaccccgctccccaaggacccggaaggcatcacagagcag
attcagtctgtttctacccctccccctcctccgcaggcgcagaaacccgcgaggcagaag
aagattgcagtcttgaccagtggtggtgactcggctggtatgaacgctgctgtccgagca
atagtccgccaatccatcgcccggggatgtcaagcctacatcatccgtgaaggctgggaa
ggtctcgtccgcggcaacacttccggccccacccctgcacccaccgccccgcaatccccc
accctttccgcctcctccaaaaccgtcaccttctcctctttgcccccctcccagcaattc
gataaactcacatctactttgaacaaggaatcactcgccaacgaagtctccttctccgac
ccgaacgaggtcaccccgctcgaggatacgcccctcagtttcgggtacggccagctcctg
agggacggagcgggtgaaggcgatgtggaagagttggcatcgcatggaatgcagggcttg
gcgattgctgatcgcgaagatgaaaagggcaggagtttgaagaacaagtatatcgtcagg
gttgggtgggatgatgtcaggggttggcaaggtgaaggcggtaccttgatcggcagttct
cgatgccctgctttccgcacaagggaaggccgactccaagcggcttccaaccttatccat
tccggcatcgactgtctcgccgtctgcggtggtgacggttccttgaccggtgccgacaag
ctccgcggcgaatggcccagcttggtggaagagctctacaccgaaaacaagattacagac
gatcagagggaagcttaccaccacctcaacattgtcggcctcgtcgggtccattgacaat
gacatggccttgaccgacttgacgatcggtgcgcttaccgccttgcaccgaatctgtgaa
tccatcgattccatctcgtccaccgcgtcctcccactcgcgtgcgtttgtgattgaagtc
atgggcagacactgcggctggctcgcgctgctcgccggtatcgcaaccggtgcagacttc
atcttcatccccgaagacccgcccaagtgcgaggactgggagacggagatgtgtgacctc
ttgcaagctcatcgaaaagtcggtaaacgcaagtcgatcgtcatcgtcgccgaaggcgcc
ctcgacaggaacttgaaacccatcaagccagactatgtgaaaaaaatcctcgtcgagcgt
ctcggtctcgatacccgtgtgaccacactcggacatacacagcgtggtggtaaaccctgt
gcgttcgacaggatcttgcccaccctccaaggcgtcgaggcggttcagacgctgttgagc
gctacacccgagacaccctcgtatatgatcggtatccaggaaaacaagattacgaaaatc
ccgcttctcgaggcggtcgcgcggactcagatggtggcggaagcgattgagaaccgggat
ttcgcaaaggccatgtctttcagagactcggaattccgagagatgctccaggctttccag
attagctcgtcacttgatgtcagccagaatgctcccgtggacaaacgattgaggatcggt
atcatccacgtcggtgcgcctgctggtggtatgaacgctgctacccgacaagccgtccga
ttctgccacaaccgaggccacgtccccgtcgccatctacaacggtttcgaaggtctcttg
gacgacaacgtctccgagctctcctggctccgggtcgactcgtggacgacccgaggcggt
tccgagcttggtacgaaccgatcgttaccttccatcgatatcggctccgtcgccgccggt
ttccagcgatactccctggacgccttgttggtcattggtggattcgaagctttccactct
gtcgtcctcctctcacaaaaccgaaccaactacccagccttccagatccccatcgtccac
ctcccagcgaccttgtcgaacaatgtacccctcacagacttttcactcggttccgatacc
tcgctcaatgcgctcgtggaagcttgtgatgccatcaagcagagtgcctcggctagtagg
aacagggtgttcgtggtagagacccagggcggaatgagtgggtatatcgcgacgatgggc
gcgctcgccgttggagctgttttggtgtacacgcccgagaatgggatttccttgaagctt
ttgcaagaggatgtagagttcttgatcaagaggtacaagttggatgagaagggtaagagt
gagggtaggttggtcatcaaagccgaaaagtcttcctctgtgtacaccaccgagactctc
accaagatcttcaaggaagaaggtaaagacctctttgacgcccgttccgcttcgctcggc
cacaccctccaaggcggtgttccctctcctctcgaccgaacccgtgccgcccgtctctca
ctaaggtgcatgcaattcctcgaagaacacgcatctcccaactcccaagcctcgcaccac
aagcccaagtctgccgcccacccgcatgcaggtgcgaaatccatcgcaaaggatacggcg
gcgatgattgcgattatcggtagcaaggttgtgtacgcgacgatggacgacgtgttgaag
gtgacggatatgaagctgaggaggggaacggacgagtggtggagtgactgtaaggagttg
gcggagacgatgggtggaaggaccggtttgatggccaagcattga

DBGET integrated database retrieval system