KEGG   Cryptococcus neoformans B-3501A: CNBJ2390Help
Entry
CNBJ2390          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cnb01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cnb01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cnb00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cnb00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cnb00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cnb00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cnb00680]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 914 aa AA seqDB search
MSDSPAATPLPKDPEGITEQIQSVSTPPPPPQAQKPARQKKIAVLTSGGDSAGMNAAVRA
IVRQSIARGCQAYIIREGWEGLVRGNTSGPTPAPTAPQSPTLSASSKTVTFSSLPPSQQF
DKLTSTLNKESLANEVSFSDPNEVTPLEDTPLSFGYGQLLRDGAGEGDVEELASHGMQGL
AIADREDEKGRSLKNKYIVRVGWDDVRGWQGEGGTLIGSSRCPAFRTREGRLQAASNLIH
SGIDCLAVCGGDGSLTGADKLRGEWPSLVEELYTENKITDDQREAYHHLNIVGLVGSIDN
DMALTDLTIGALTALHRICESIDSISSTASSHSRAFVIEVMGRHCGWLALLAGIATGADF
IFIPEDPPKCEDWETEMCDLLQAHRKVGKRKSIVIVAEGALDRNLKPIKPDYVKKILVER
LGLDTRVTTLGHTQRGGKPCAFDRILPTLQGVEAVQTLLSATPETPSYMIGIQENKITKI
PLLEAVARTQMVAEAIENRDFAKAMSFRDSEFREMLQAFQISSSLDVSQNAPVDKRLRIG
IIHVGAPAGGMNAATRQAVRFCHNRGHVPVAIYNGFEGLLDDNVSELSWLRVDSWTTRGG
SELGTNRSLPSIDIGSVAAGFQRYSLDALLVIGGFEAFHSVVLLSQNRTNYPAFQIPIVH
LPATLSNNVPLTDFSLGSDTSLNALVEACDAIKQSASASRNRVFVVETQGGMSGYIATMG
ALAVGAVLVYTPENGISLKLLQEDVEFLIKRYKLDEKGKSEGRLVIKAEKSSSVYTTETL
TKIFKEEGKDLFDARSASLGHTLQGGVPSPLDRTRAARLSLRCMQFLEEHASPNSQASHH
KPKSAAHPHAGAKSIAKDTAAMIAIIGSKVVYATMDDVLKVTDMKLRRGTDEWWSDCKEL
AETMGGRTGLMAKH
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atgtccgactcgccggccgccaccccgctccccaaggacccggaaggcatcacagagcag
attcagtctgtttctacccctccccctcctccgcaggcgcagaaacccgcgaggcagaag
aagattgcagtcttgaccagtggtggtgactcggctggtatgaacgctgctgtccgagca
atagtccgccaatccatcgcccggggatgtcaagcctacatcatccgtgaaggctgggaa
ggtctcgtccgcggcaacacttccggccccacccctgcacccaccgccccgcaatccccc
accctttccgcctcctccaaaaccgtcaccttctcctctttgcccccctcccagcaattc
gataaactcacatctactttgaacaaggaatcactcgccaacgaagtctccttctccgac
ccgaacgaggtcaccccgctcgaggatacgcccctcagtttcgggtacggccagctcctg
agggacggagcgggtgaaggcgatgtggaagagttggcatcgcatggaatgcagggcttg
gcgattgctgatcgcgaagatgaaaagggcaggagtttgaagaacaagtatatcgtcagg
gttgggtgggatgatgtcaggggttggcaaggtgaaggcggtaccttgatcggcagttct
cgatgccctgctttccgcacaagggaaggccgactccaagcggcttccaaccttatccat
tccggcatcgactgtctcgccgtctgcggtggtgacggttccttgaccggtgccgacaag
ctccgcggcgaatggcccagcttggtggaagagctctacaccgaaaacaagattacagac
gatcagagggaagcttaccaccacctcaacattgtcggcctcgtcgggtccattgacaat
gacatggccttgaccgacttgacgatcggtgcgcttaccgccttgcaccgaatctgtgaa
tccatcgattccatctcgtccaccgcgtcctcccactcgcgtgcgtttgtgattgaagtc
atgggcagacactgcggctggctcgcgctgctcgccggtatcgcaaccggtgcagacttc
atcttcatccccgaagacccgcccaagtgcgaggactgggagacggagatgtgtgacctc
ttgcaagctcatcgaaaagtcggtaaacgcaagtcgatcgtcatcgtcgccgaaggcgcc
ctcgacaggaacttgaaacccatcaagccagactatgtgaaaaaaatcctcgtcgagcgt
ctcggtctcgatacccgtgtgaccacactcggacatacacagcgtggtggtaaaccctgt
gcgttcgacaggatcttgcccaccctccaaggcgtcgaggcggttcagacgctgttgagc
gctacacccgagacaccctcgtatatgatcggtatccaggaaaacaagattacgaaaatc
ccgcttctcgaggcggtcgcgcggactcagatggtggcggaagcgattgagaaccgggat
ttcgcaaaggccatgtctttcagagactcggaattccgagagatgctccaggctttccag
attagctcgtcacttgatgtcagccagaatgctcccgtggacaaacgattgaggatcggt
atcatccacgtcggtgcgcctgctggtggtatgaacgctgctacccgacaagccgtccga
ttctgccacaaccgaggccacgtccccgtcgccatctacaacggtttcgaaggtctcttg
gacgacaacgtctccgagctctcctggctccgggtcgactcgtggacgacccgaggcggt
tccgagcttggtacgaaccgatcgttaccttccatcgatatcggctccgtcgccgccggt
ttccagcgatactccctggacgccttgttggtcattggtggattcgaagctttccactct
gtcgtcctcctctcacaaaaccgaaccaactacccagccttccagatccccatcgtccac
ctcccagcgaccttgtcgaacaatgtacccctcacagacttttcactcggttccgatacc
tcgctcaatgcgctcgtggaagcttgtgatgccatcaagcagagtgcctcggctagtagg
aacagggtgttcgtggtagagacccagggcggaatgagtgggtatatcgcgacgatgggc
gcgctcgccgttggagctgttttggtgtacacgcccgagaatgggatttccttgaagctt
ttgcaagaggatgtagagttcttgatcaagaggtacaagttggatgagaagggtaagagt
gagggtaggttggtcatcaaagccgaaaagtcttcctctgtgtacaccaccgagactctc
accaagatcttcaaggaagaaggtaaagacctctttgacgcccgttccgcttcgctcggc
cacaccctccaaggcggtgttccctctcctctcgaccgaacccgtgccgcccgtctctca
ctaaggtgcatgcaattcctcgaagaacacgcatctcccaactcccaagcctcgcaccac
aagcccaagtctgccgcccacccgcatgcaggtgcgaaatccatcgcaaaggatacggcg
gcgatgattgcgattatcggtagcaaggttgtgtacgcgacgatggacgacgtgttgaag
gtgacggatatgaagctgaggaggggaacggacgagtggtggagtgactgtaaggagttg
gcggagacgatgggtggaaggaccggtttgatggccaagcattga

DBGET integrated database retrieval system