KEGG   Cryptococcus neoformans B-3501A: CNBJ2910Help
Entry
CNBJ2910          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CNBJ2910
Enzymes [BR:cnb01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     CNBJ2910
Glycosyltransferases [BR:cnb01003]
 Polysaccharide
  Storage polysaccharide
   CNBJ2910
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10
AA seq 733 aa AA seqDB search
MPRSVHNPFLFEAAWEVANKVGGIYTVIKTKVPVTVREYGDRLCLIGPLSYKSAPVEVEA
EEPGPGPFGDALRSMQERGVKLLYGRWLIEGAPRVLLFDTGSCYDRMDEWKGDLWNLAGI
PSPPNDHETNETIVFGYMVAWFLGEFAARETDNAIVAHFHEWQAGLAIPLCRKRHIDVTT
IFTTHATLLGRYLCAGSVDFYNNLQYFDVDHEAGKRGIYHRYCIERSSAHCADVFTTVSH
ITAFESEHLLKRKPDGVLPNGLNVVKFAAMHEFQNLHVQSKEKINEFIRGHFYGHYDFDL
DNTIYMFTAGRYEFRNKGVDMFIESLARLNHRLKKMGSKTTVVAFIIMPAATNSYTIEAL
KGQAVTSQLKDCVEQVTNRISKRIFEHACRYSGEHGTEVPNPEDLLSNEDRVLLKRRVFA
LKRNSLPPIVTHNMADDANDPILNQLRRVQLFNRPEDRVKVIFHPEFLNSNNPILGLDYE
EFVRGCHLGVFPSYYEPFGYTPAECTVMGIPNITTNLSGFGCFMEDLLESPEDYGCYIVD
RRGQGIEESVDQLTGQLLSFTTKSRRQRINQRNRTERLSELLDWKSLGLEYAKARQLALR
RAYPDSFNDDEPDFTGVQKVGAPLSAPASPRMRTGMMTPGDYATLTEEMEHLSTQDYMGA
KSWKGINDDDDENHYPFPLVMKPRKRSDSLASAISGNATPSGGRKLSENDLARADAALSN
VEGVHADGINGHH
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgcctcgttccgtccacaacccgttcctttttgaggctgcttgggaagttgccaacaag
gtcggaggtatttacaccgtcatcaagaccaaggtgcctgttactgtcagagaatacggt
gaccgcttatgtttgattggccccttgtcttataaatctgctcctgtagaagtcgaagcc
gaggagcctggaccgggaccgttcggagatgctctcaggtctatgcaggagcgcggcgtc
aagcttctttacggccgatggcttattgaaggcgcccctagagtgttgctctttgacacg
gggtcttgttacgaccgtatggacgaatggaagggtgacctctggaaccttgccggtatc
ccctcgcctccaaatgatcacgagaccaacgaaactatcgtctttggctacatggtcgcc
tggttcctcggcgagttcgctgctcgcgaaaccgacaacgccatcgttgcccacttccat
gaatggcaagccggtttagccatccctctttgtaggaagcgacacattgacgtcaccacc
atcttcaccacccacgcgactcttttgggtcgttacctctgtgctggcagtgtcgacttt
tacaacaacttgcagtactttgacgttgatcatgaagctggtaagcggggtatctaccac
cgttactgtatcgaaaggtcttctgcacactgcgccgatgtgttcaccaccgtcagccac
attaccgcgtttgagagcgaacacttgttgaagaggaagcctgatggtgtcctccccaac
ggtctcaacgttgtcaagtttgccgccatgcacgaattccagaatttgcatgttcagtcc
aaggagaagatcaacgaattcattcgtggtcatttctatggtcactatgactttgacctg
gacaacaccatttacatgttcactgctggtcgttacgagttcaggaacaagggtgtcgac
atgttcattgaaagtttagctcggttgaatcatcgcttgaagaagatgggctccaagacc
accgtcgtcgcattcatcatcatgcccgccgctaccaactcttacactatcgaagctctc
aaaggtcaagctgtcacctcccagctcaaggactgtgtcgagcaagtgaccaatcgtatc
agcaagcgaatctttgaacacgcctgtcgatactctggcgagcacggtacagaggttcct
aatcctgaagatttgctctccaacgaggacagggttttgctcaagcgaagggtgttcgcc
ctgaagcgaaactctctgccgcctatcgtcacgcacaatatggcggatgacgcaaatgac
cctattttgaaccagctcaggagggtacagttgttcaacaggcccgaagacagggtcaag
gttatcttccaccccgaattcttgaacagtaacaaccccatcttgggtctggattatgaa
gagtttgttaggggttgtcacttgggtgttttccctagttactacgagcccttcggttat
acccccgccgagtgtactgtcatgggtattcccaacatcactaccaacttgtccggtttc
ggttgctttatggaagacctcctggagtctcccgaggactacggttgttacattgtcgac
cgacgaggtcaaggtatcgaagaatctgtcgaccagctcaccggccagctgctctctttc
accaccaaatccagaagacagcgtatcaaccagcgtaaccgtactgaacgcctgagcgag
ttgctggactggaagtccctcggtctcgagtacgccaaggctcgtcaattggctttgagg
cgagcttaccccgactcatttaatgatgatgagcccgacttcactggtgtgcaaaaggtt
ggcgcgccgctctctgcgcctgcgagcccgaggatgaggactgggatgatgactcctggg
gattatgccactttgactgaagagatggaacatctttctactcaagactacatgggtgct
aagagctggaaaggcatcaacgatgatgatgacgagaaccattatcctttccctctcgtc
atgaagccccgtaaacgctccgactctctcgcttctgccatctctggtaacgctacccct
tctggcggtaggaagctctccgaaaatgatttggccagggccgatgctgctttgagcaat
gttgagggggttcacgccgacggaatcaacggacatcattag

  All links  
No link information was found.   
DBGET integrated database retrieval system