KEGG   Cryptococcus neoformans B-3501A: CNBK1310Help
Entry
CNBK1310          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K11427  
histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    CNBK1310
Enzymes [BR:cnb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CNBK1310
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 644 aa AA seqDB search
MFSFFGDESKLPASTVMVSRMTVKKQAAARQQSSGPMAGPSKPSNVTPKHSHGSLKGTPR
SASEKGTPKQGPSSSSKSTSKVKQEERIRPSTIPRTPASSSSPGRLKRKTPKVQVVESES
SSGSESSDDALDSKPKRPKVTRKETGIDMTPLPGEQVVGRRVFCWDKVDMRGEWGRGWAG
FVGCDEVVRGNVQGWANGGGGDGSKNLGKYRAFFPQEGFDRDGDFLPSVEVLYPAKGCRE
KFVLMVPSSDREFNPIGELRNTLRLILEHYIPPSHRHIFGNLAESLDISNPLSSLPSRMT
TPLPNSLVTPPPDPASPSPAFAFEISATSTPAPSTERQETIADLIRKSLAPNRRDGPLFV
TAIERYNSAMQAIQEDGTLQQWLDEGMNGGKGIKVREWAALVDFVHDQAYSRVVGGYSHE
LEHHPKHPEEVSKAISGKEDAYGELRHAFMSKIIEQTKLGPDSVFVDLGSGVGNCVLQAS
LQAGSRSYGFELLPVPAHCARLQVREVQRRWAMWALKGNLDVEVHEGDFRVHKEVGRRLR
EADVVLVNNEVFPSSLNMDLADMFLDLKEGAKIVSLKPFVPEGFRMNESNCDSFAAILRS
TQHDYYRDWVSWKGEWGNYYVAVIDRSRRIKFEESMTGRASRRR
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgttctcttttttcggcgacgagtccaagttaccagcttcgaccgtcatggtcagccgc
atgaccgtcaaaaagcaagctgctgcccggcagcagtcttcaggacctatggcagggccc
tcgaaaccatcgaatgtaactcccaagcactcgcatggttctcttaaagggacaccgagg
tcagcgtcagaaaaagggacaccgaagcaaggaccaagctcatcctcaaaaagtacttca
aaagtcaagcaagaggagcgtatcaggccgtcgaccatacctcgtactcctgcatcctca
tctagtcctggaagactgaagagaaaaacgccgaaagtccaagtagtcgagtctgagtcc
tcaagtggatcagaatcaagcgatgatgcccttgattccaaacccaaacgaccaaaagtt
acccgaaaagagacaggaattgacatgacgcctctgcctggagaacaagttgtgggccga
agggtattttgttgggataaggtggatatgcgaggtgaatggggaaggggctgggcgggt
tttgtggggtgcgatgaagttgttagaggaaatgtgcaaggatgggcgaacggaggaggt
ggagatgggagcaagaatttggggaagtacagagctttctttccccaagaaggctttgat
agggatggggactttctaccatcagtggaagtactttaccccgcgaaaggatgccgagaa
aaatttgtccttatggtgccctcatcggacagggagtttaatcccataggcgagcttcgt
aatactttaagattaatacttgaacattacatacctccatcccaccgtcatatattcggg
aatctggcggagtcattggacatttccaatccactctcgtctttgccatcacgtatgaca
acccctcttcctaactcactcgtgacaccaccacccgatcctgcctccccttccccggcc
tttgccttcgaaatttccgccacttctacccctgcgccatccaccgaaagacaagaaaca
atcgcagacttgatacggaaatctcttgcccctaatcgtcgagatggtcccttattcgtg
accgccatcgaacggtacaattcggctatgcaggctatacaagaggatgggacgttgcaa
caatggttagatgagggtatgaatggtgggaaaggaatcaaagtcagagaatgggctgca
ttagttgacttcgtgcatgatcaagcctattccagggttgtaggtggatatagtcatgag
ttggagcatcatcccaagcatcccgaagaggtgtcaaaggccatcagcgggaaggaagat
gcttatggagaattgaggcacgcgtttatgagcaagatcatagaacaaacaaagctagga
cctgactctgtattcgtcgatcttggtagtggtgttggcaactgcgtacttcaagcatct
cttcaagcaggttccagaagctatggtttcgaacttctacccgttccggctcactgtgct
cgtctacaagtgcgggaggtacagaggagatgggctatgtgggcattgaaaggaaatctg
gatgtggaagtgcacgagggagactttagggttcacaaggaggttggccgaagactaagg
gaagccgatgttgtgctggtcaacaacgaagtgtttccgtcatcattgaatatggacctt
gcggatatgttcctcgatttaaaggagggtgcaaagattgtcagtctcaagccctttgtg
ccagaaggtttcagaatgaatgaaagtaactgcgactctttcgccgctatcctccgctct
acccagcacgactactaccgagactgggtgtcatggaaaggcgagtggggcaactattat
gtggctgtcattgatcgatcgaggaggatcaagttcgaagaaagtatgacgggaagggcg
tctagaagacgctga

DBGET integrated database retrieval system