KEGG   Cryptococcus neoformans B-3501A: CNBK2430Help
Entry
CNBK2430          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CNBK2430
Enzymes [BR:cnb01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CNBK2430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 283 aa AA seqDB search
MGVSQNEKSVILTHESGCSAEIYFYGATVVSWKQGGKERMFVSSKSAMDGSKAIRGGIPV
VFPIFGPPPPSPPEYASLGQHGFARTSTWKFDSVVMDRPEGVSVRFVLPSAPPTFLHEFK
LSYVVTLAPHQLSTDLHVVNSGKEKFSFQALLHNYLAVPDSSKIKITGIDKGTTYKDKVL
GGKMDEWDGSTLVIDREIDRVYQKVPSREITVDDGAGSGYKVRFRGFEDCTIWNPQEATG
SKMADMEDKGWDKYVCIEPGYVREFKTLSPSQELILAQTITVL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctcacaaaatgaaaagagcgtcatacttacccatgaatcagggtgctccgcc
gaaatttacttctacggcgccactgtagtgtcttggaagcaaggcggcaaggaacgcatg
ttcgtgagctccaaatcagccatggacggttccaaggcgatccgaggtggtatccctgtc
gtcttccccatctttggccctcctcctccttctcctccagagtacgcttccctcggacaa
cacggttttgcgcgaaccagtacctggaagtttgactctgtcgtgatggaccgccccgaa
ggtgtctctgtccgattcgtcttgccttctgcgcctccaacgttcctccacgaattcaag
cttagctacgtcgtcactctcgccccccaccaactatctaccgacttgcacgtggttaac
tctgggaaagagaagtttagcttccaggccttgttgcacaattacttggccgtccccgac
tccagcaagattaaaatcactggaattgacaagggtaccacttataaagataaggttctg
ggaggaaagatggatgaatgggatggcagcactcttgtcatcgatcgagaaattgaccga
gtctaccagaaggtgccctcgcgggaaatcactgtggacgacggtgccggatctggttac
aaggtccgattccgaggttttgaggactgtactatctggaaccctcaagaagcgaccggt
agtaaaatggctgatatggaggacaaaggctgggacaagtatgtttgtattgagcctggc
tacgtcagggaattcaagaccttatctccctctcaagagcttatcttggctcagaccatc
accgtgctctag

DBGET integrated database retrieval system