KEGG   Cryptococcus neoformans var. neoformans B-3501A: CNBK2550Help
Entry
CNBK2550          CDS       T01040                                 

Definition
(RefSeq) hypothetical protein
  KO
K07739  elongator complex protein 3 [EC:2.3.1.48]
Organism
cnb  Cryptococcus neoformans var. neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CNBK2550
Transfer RNA biogenesis [BR:cnb03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CNBK2550
Chromosome [BR:cnb03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    CNBK2550
   HAT complexes
    Elongator complex
     CNBK2550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Radical_SAM_C Radical_SAM Acetyltransf_1 Acetyltransf_10 Acetyltransf_7
Motif
Other DBs
NCBI-GeneID: 4938953
NCBI-ProteinID: XP_772884
UniProt: F5HC86
Position
11
AA seq 557 aa AA seqDB search
MIAPTTSQSELHLLCVSAVVRDLISTYNSSSSSATQPPNVNSLRAKYAKKYGLKAVPRLT
DVLAAVPEEWKDRLRGWLRAKPVRTASGVAVVAVMCKPHRCPHVAMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVNQLRDLGHSVDKVEIIIMGGTFMSMP
EDYRHKFIAGLHNALSGHTGEDVDEAVKFSEQSKVKCVGITIETRPDYCLKPHLSQMLRY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVSESFHMSKDAGYKIVAHMMPDLPNCGTERDI
WQFQEFFENPAFRSDGLKLYPTLVIRGTGLYELWRTGKYKNYPPNALVDIVARIMALVPP
WTRVYRVQRDIPMPLVSSGVENGNLRELALARMKDFGAECRDVRYREVGLHEIHHRVRPR
DIELIRRDYAANGGWETFLSYEDPQSDILVGLLRLRKCSEEGTFRKELVGMQGGCSLVRE
LHVYGTAAPVHSRDPKKFQHQGIGTLLMEEAERIAREEHGSGRIAVISGVGTRDYYRRLG
YFLDGPYMVKDLLYDDE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcacccacaacctcacagtcggaactgcaccttctatgtgtatccgccgtggtc
agagacctcatctcaacctataattcctcaagcagctccgccacccagcctccaaacgta
aacagtcttcgagcaaaatacgcaaaaaaatacggactcaaggcagtccctcgtttgaca
gatgtcctcgctgctgtccctgaagaatggaaggacaggctgaggggatggctgagagca
aagccagtcaggacggcgagcggtgtggcagttgttgctgtcatgtgcaaaccccatcga
tgtcctcacgtagccatgaccggaaacatctgcgtctactgccccggcggtcctgactct
gactttgaatactcaacccagtcatacactggatatgagcctacttctatgcgagccatc
cgggccagatatgacccatatgagcaagcgcgtggacgtgtgaaccagctccgtgacctt
ggacacagcgtcgacaaggttgagatcattatcatgggaggaacgttcatgtccatgccg
gaagactaccgccataaattcattgctggacttcacaatgccttgagtggtcacactgga
gaggacgttgacgaggctgtcaaattctctgagcaaagcaaggtcaaatgcgttggtatc
actattgaaacccgtcccgattactgcttgaagcctcatctgagtcagatgttgaggtat
ggatgcacccgtctggaaatcggtgttcaatcagtctatgaagacgtggcacgagacacc
aaccgaggacacactgtccgagctgtcagtgaatccttccacatgtccaaagacgccggc
tacaagattgtcgcccacatgatgcctgacctccccaactgcggtaccgagcgagacatt
tggcaattccaagaattctttgaaaaccccgctttccgatcagacggactcaaactgtac
ccaaccttggtcatccgtggtaccggtctttacgaactgtggaggactggcaagtacaag
aattaccctcccaacgcccttgtcgatatcgtagcgaggatcatggcgctcgtacccccc
tggacgcgagtctaccgcgtccaacgagatatcccgatgccgctcgtctcttccggcgtg
gagaatggtaatttacgtgaactcgcacttgcgcgtatgaaggatttcggtgccgagtgt
cgagatgtgcgataccgtgaggtcggtctgcacgagattcaccaccgtgtgcgaccgcgt
gatatcgagcttatccgaagagattacgcggcgaatggcggatgggagacgttcttgtcg
tatgaggatcctcagtctgatatcttggtcggtcttttgaggttgagaaagtgttcagag
gaagggacgtttaggaaggagttggttggtatgcaaggtggatgcagccttgtgcgagag
ctgcacgtgtatggtactgctgcacccgttcactctcgtgaccccaagaaattccagcat
caaggtatcggtacattattgatggaagaggcggagcgtatcgcccgtgaggagcacggt
agcggtcggatcgctgtaatctctggtgttggaacgcgtgattactatcgacggcttggt
tactttctcgatgggccttatatggtcaaggatcttttgtacgatgacgagtag

DBGET integrated database retrieval system