KEGG   Cryptococcus neoformans B-3501A: CNBK2550Help
Entry
CNBK2550          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cnb  Cryptococcus neoformans B-3501A
Brite
Enzymes [BR:cnb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     CNBK2550
Transfer RNA biogenesis [BR:cnb03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    CNBK2550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11
AA seq 557 aa AA seqDB search
MIAPTTSQSELHLLCVSAVVRDLISTYNSSSSSATQPPNVNSLRAKYAKKYGLKAVPRLT
DVLAAVPEEWKDRLRGWLRAKPVRTASGVAVVAVMCKPHRCPHVAMTGNICVYCPGGPDS
DFEYSTQSYTGYEPTSMRAIRARYDPYEQARGRVNQLRDLGHSVDKVEIIIMGGTFMSMP
EDYRHKFIAGLHNALSGHTGEDVDEAVKFSEQSKVKCVGITIETRPDYCLKPHLSQMLRY
GCTRLEIGVQSVYEDVARDTNRGHTVRAVSESFHMSKDAGYKIVAHMMPDLPNCGTERDI
WQFQEFFENPAFRSDGLKLYPTLVIRGTGLYELWRTGKYKNYPPNALVDIVARIMALVPP
WTRVYRVQRDIPMPLVSSGVENGNLRELALARMKDFGAECRDVRYREVGLHEIHHRVRPR
DIELIRRDYAANGGWETFLSYEDPQSDILVGLLRLRKCSEEGTFRKELVGMQGGCSLVRE
LHVYGTAAPVHSRDPKKFQHQGIGTLLMEEAERIAREEHGSGRIAVISGVGTRDYYRRLG
YFLDGPYMVKDLLYDDE
NT seq 1674 nt NT seq  +upstreamnt  +downstreamnt
atgatcgcacccacaacctcacagtcggaactgcaccttctatgtgtatccgccgtggtc
agagacctcatctcaacctataattcctcaagcagctccgccacccagcctccaaacgta
aacagtcttcgagcaaaatacgcaaaaaaatacggactcaaggcagtccctcgtttgaca
gatgtcctcgctgctgtccctgaagaatggaaggacaggctgaggggatggctgagagca
aagccagtcaggacggcgagcggtgtggcagttgttgctgtcatgtgcaaaccccatcga
tgtcctcacgtagccatgaccggaaacatctgcgtctactgccccggcggtcctgactct
gactttgaatactcaacccagtcatacactggatatgagcctacttctatgcgagccatc
cgggccagatatgacccatatgagcaagcgcgtggacgtgtgaaccagctccgtgacctt
ggacacagcgtcgacaaggttgagatcattatcatgggaggaacgttcatgtccatgccg
gaagactaccgccataaattcattgctggacttcacaatgccttgagtggtcacactgga
gaggacgttgacgaggctgtcaaattctctgagcaaagcaaggtcaaatgcgttggtatc
actattgaaacccgtcccgattactgcttgaagcctcatctgagtcagatgttgaggtat
ggatgcacccgtctggaaatcggtgttcaatcagtctatgaagacgtggcacgagacacc
aaccgaggacacactgtccgagctgtcagtgaatccttccacatgtccaaagacgccggc
tacaagattgtcgcccacatgatgcctgacctccccaactgcggtaccgagcgagacatt
tggcaattccaagaattctttgaaaaccccgctttccgatcagacggactcaaactgtac
ccaaccttggtcatccgtggtaccggtctttacgaactgtggaggactggcaagtacaag
aattaccctcccaacgcccttgtcgatatcgtagcgaggatcatggcgctcgtacccccc
tggacgcgagtctaccgcgtccaacgagatatcccgatgccgctcgtctcttccggcgtg
gagaatggtaatttacgtgaactcgcacttgcgcgtatgaaggatttcggtgccgagtgt
cgagatgtgcgataccgtgaggtcggtctgcacgagattcaccaccgtgtgcgaccgcgt
gatatcgagcttatccgaagagattacgcggcgaatggcggatgggagacgttcttgtcg
tatgaggatcctcagtctgatatcttggtcggtcttttgaggttgagaaagtgttcagag
gaagggacgtttaggaaggagttggttggtatgcaaggtggatgcagccttgtgcgagag
ctgcacgtgtatggtactgctgcacccgttcactctcgtgaccccaagaaattccagcat
caaggtatcggtacattattgatggaagaggcggagcgtatcgcccgtgaggagcacggt
agcggtcggatcgctgtaatctctggtgttggaacgcgtgattactatcgacggcttggt
tactttctcgatgggccttatatggtcaaggatcttttgtacgatgacgagtag

DBGET integrated database retrieval system