KEGG   Cryptococcus neoformans B-3501A: CNBL0510Help
Entry
CNBL0510          CDS       T01040                                 

Definition
hypothetical protein
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
cnb  Cryptococcus neoformans B-3501A
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:cnb00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CNBL0510
  Amino acid metabolism
   00330 Arginine and proline metabolism
    CNBL0510
Enzymes [BR:cnb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     CNBL0510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
12
AA seq 519 aa AA seqDB search
MSGKSKFTPLTIVIKLGTSSIVSPTYPFVPHLRLLSSIVETVVKLRTQGHRVVLVSSGAI
GVGLRRMDLKERGKGLHQKQSHDQQALAAVGQGRLIALWDNLFSQLDQPIAQILLTRMDI
SDVTQRTRYLNAQNTFSELLQMGVIPIVNENDTVSVSEIKFGDNDTLSAISSAICHADYL
FLLTDVDCLYTDNPRTNPDAKPVRVVRDIEKVKQQVSTSTLGTSLGTGGMSTKLIAAELA
TAAGTTTVVMHSINVTDIFKVIENGPSPCREVAETPELFEGPLCTRFLRRESALKDRKWW
IAHGLHAAGTVVIDEGACRAIRRKESGGRLLPAGVVRVVGPFASHQAVRLVVRRRRHDDI
AALSSVDESTPGSPTPDLSQVPQPATFASPALRHLTIGTTNPITVMSDANNTEPDTPQLQ
PSMSLSSSIASLDPLSRSVPPSPAITALAERLGTTSLTSIGRGVAEGESDEWEEVEVAKG
LAQYNSVEIDRMKGRKSSEIEKLIGYVESEHVVDSITFL
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgtccggtaaatcaaaattcacccctctgactatcgtcattaagctcggtacctcatct
attgtatccccgacatatccttttgtcccccaccttcgacttctttcatctattgttgag
actgtagtgaaactccggacccaaggacatcgtgtcgtcttggtatcttcgggtgctatc
ggtgtggggttaaggaggatggatcttaaggaaagagggaaggggttgcatcagaagcag
tcacacgaccaacaggcccttgctgctgttggtcaagggcggctgattgcgctgtgggat
aatctgttttctcaattggatcagcctattgcccagattcttctcacccgaatggacatt
tcagacgtgacacagagaacgcgttatctcaacgctcaaaacactttctctgaattattg
caaatgggcgttattcctatcgtcaatgagaatgatacagtctcagtatctgaaatcaaa
tttggcgacaatgacacattatcggcgatctcttctgctatctgccatgccgactatctc
ttccttttgactgacgttgactgtttatacacagacaacccccgtaccaaccccgatgcg
aagcctgtgagagtcgtacgcgatattgagaaggtgaaacagcaagtatctacttctacc
ctcggaacatctcttggcacaggaggcatgtccacaaagctcattgcggccgagcttgct
accgctgctggcacaaccaccgttgttatgcattctatcaacgtaactgacattttcaaa
gtcattgaaaacggcccttcgccttgccgagaggttgcagagactccagaattgtttgag
ggcccactgtgtacgaggtttttaagacgagagtcagcccttaaagaccgaaaatggtgg
atcgcccacggtcttcacgctgccggtaccgttgtcatcgacgaaggtgcctgccgtgcc
attcgacgcaaagaatccggtggtcgtcttcttcctgccggtgtcgtccgcgtggttggc
cctttcgcaagtcaccaagccgtccgtctcgttgttcgccgtcgacgccacgacgacatc
gctgcccttagctcagtcgacgaatcaacccccggtagccctacccccgacctttcccaa
gtaccccagccggcgacattcgcttctcctgctcttcgacaccttacgattgggactacc
aatcctatcaccgtcatgtccgacgccaacaacactgaacctgatactcctcaactccaa
ccttccatgtctctttcatcgtcgatcgcttccctcgaccctttgagcaggagtgtgccc
cctagtcctgcgataacggctttggcggagaggttgggcacgacatcgttaacgagtatt
gggcggggagtggccgaaggagagagtgatgagtgggaagaggtcgaggtggcgaagggt
ctagctcaatacaacagtgtagaaattgacaggatgaagggacgaaagagttcggaaatt
gaaaaacttattggatacgtcgagagcgagcatgtggtggactcgattaccttcttgtag

DBGET integrated database retrieval system